IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. Cancer Cell (1535-6108) 2013 imex curation Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-pro b cells Mus musculus pro-b-cell pro b cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Accepted 2013-OCT-02 by PPORRAS 14-Oct-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. Cancer Cell (1535-6108) 2013 imex curation Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-pro b cells Mus musculus pro-b-cell pro b cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Accepted 2013-OCT-02 by PPORRAS 14-Oct-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. Cancer Cell (1535-6108) 2013 imex curation Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-pro b cells Mus musculus pro-b-cell pro b cell ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Accepted 2013-OCT-02 by PPORRAS 14-Oct-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. A Kinase-Independent Function of CDK6 Links the Cell Cycle to Tumor Angiogenesis. Cancer Cell (1535-6108) 2013 imex curation Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at 14-Oct-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kollmann K., Heller G., Schneckenleithner C., Warsch W., Scheicher R., Ott R.G., Schäfer M., Fajmann S., Schlederer M., Schiefer A.I., Reichart U., Mayerhofer M., Hoeller C., Zöchbauer-Müller S., Kerjaschki D., Bock C., Kenner L., Hoefler G., Freissmuth M., Green A.R., Moriggl R., Busslinger M., Malumbres M., Sexl V. Cancer - Interactions investigated in the context of cancer Interactions using antibodies to H3 have not been included owing to lack of antibody specificity. p185 BCR-ABL-transformed pro B cell line infected with a retrovirus to express CDK6, HA-tagged CDK6 or the CDK6K43M mutant. veronika.sexl@vetmeduni.ac.at Accepted 2013-OCT-02 by PPORRAS 14-Oct-2013: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2013 Only protein-protein interactions imex curation stat3_mouse Signal transducer and activator of transcription 3 Acute-phase response factor Stat3 Aprf protein protein mouse Mus musculus Mouse MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM DIP protein P42227 original sequence version: 169 DIP protein P42227 original sequence version: 162 DIP protein P42227 original sequence version: 164 DIP protein P42227 original sequence version: 141 6C00626711C8012D jun_mouse Transcription factor AP-1 Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog AH119 Jun protein protein mouse Mus musculus Mouse MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05627 original sequence version: 134 2BE0E4025B8B1CA3 ccnd2_mouse G1/S-specific cyclin-D2 Ccnd2 Cyl-2 protein protein mouse Mus musculus Mouse MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL DIP protein P30280 original sequence version: 108 58F322771DD1DA3D ccnd3_mouse G1/S-specific cyclin-D3 Ccnd3 Cyl-3 protein protein mouse Mus musculus Mouse MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQKEIKPHMRKMLAYWMLEVCEEQRCEEDVFPLAMNYLDRYLSCVPTRKAQLQLLGTVCLLLASKLRETTPLTIEKLCIYTDQAVAPWQLREWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPSDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVLGLGACSMSADELTELLAGITGTEVDCLRACQEQIEAALRESLREAAQTAPSPVPKAPRGSSSQGPSQTSTPTDVTAIHL 5441639A9B1B1475 vegfa_mouse_gene Mouse VEGFA gene gene gene mouse Mus musculus Mouse cdk4_mouse Cyclin-dependent kinase 4 Cell division protein kinase 4 PSK-J3 CRK3 Cdk4 Crk3 protein protein mouse Mus musculus Mouse MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE DIP protein P30285 original sequence version: 145 DIP protein P30285 original sequence version: 129 DIP protein P30285 original sequence version: 82 DIP protein P30285 original sequence version: 102 CB4F42A8AA13634A cdk6_mouse Cyclin-dependent kinase 6 Serine/threonine-protein kinase PLSTIRE Cdkn6 Cdk6 Crk2 Cell division protein kinase 6 CR2 protein kinase protein protein mouse Mus musculus Mouse MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDIIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALNHPYFQDLERYKDNLNSHLPSNQSTSELNTA 127B7ECFFC54C3AC cd2a2_mouse_gene Cyclin-dependent kinase inhibitor 2A gene gene mouse Mus musculus Mouse rpb1_mouse DNA-directed RNA polymerase II subunit RPB1 Polr2a Rpii215 Rpo2-1 DNA-directed RNA polymerase II subunit A DNA-directed RNA polymerase III largest subunit protein protein mouse Mus musculus Mouse MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTGMFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPTSPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKYSPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTSPKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN DIP protein P08775 original sequence version: 94 DIP protein P08775 original sequence version: 114 DIP protein P08775 original sequence version: 110 DIP protein P08775 original sequence version: 123 7D76F38FD92A657E cdk6-cd2a2 2 11 unspecified role unspecified role bait bait Q64261:p.Lys43Met mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K M Wed May 02 16:14:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys43met' Tue Jun 30 20:22:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys43Met' 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 2D, Supp 6I cdk6-cd2a2-1 2 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C cdk6-vegfa 2 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6D, Supp 6I stat3-cdk6 1 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 7A stat3-cdk6-1 1 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 7B jun-cdk6 3 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey association association 7G stat3-cd2a2 3 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7G jun-cdk6-1 3 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7Gi polr2a-vegfa 2 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role ancillary ancillary association association Supp 6I cdk6-cd2a2-2 2 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait association association Supp 7B cdk6-vegfa-1 2 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7B cdk6-vegfa-2 2 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7C cdk6-ccnd2-1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association Supp 7D cdk6-ccnd2-2 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Supp 7Di stat3-cd2a2-1 3 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7E Using CDK KO cells Cyclin 2 does not bind to either Vegf-A or p16INK4a promoter. stat3-cdk6-2 3 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7E Using CDK KO cells Cyclin 2 does not bind to either Vegf-A or p16INK4a promoter. ccnd2-cdk6 4 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7F Using cyclin 1/2/3 KO cells CDK6 still binds to the p16INK4a promoter. ccnd2-cd2a2-1 4 7 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp 7Fi