Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com A critical role for lymphatic endothelial heparan sulfate in lymph node metastasis. A critical role for lymphatic endothelial heparan sulfate in lymph node metastasis. Mol. Cancer (null) 2010 imex curation Yin X., Truty J., Lawrence R., Johns SC., Srinivasan RS., Handel TM., Fuster MM. Cancer - Interactions investigated in the context of cancer hLEC: Primary human lymphatic endothelial cells mfuster@ucsd.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Yin X., Truty J., Lawrence R., Johns SC., Srinivasan RS., Handel TM., Fuster MM. Cancer - Interactions investigated in the context of cancer hLEC: Primary human lymphatic endothelial cells mfuster@ucsd.edu Accepted 2011-FEB-09 by JYOTI 06-April-2011: Contacted by JYOTI. Mol. Cancer (null) 2010 jyoti Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd ccr7_human C-C chemokine receptor type 7 CCR7 CMKBR7 EBI1 EVI1 BLR2 CDw197 Epstein-Barr virus-induced G-protein coupled receptor 1 MIP-3 beta receptor protein protein human Homo sapiens Human MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP DIP protein P32248 original sequence version: 139 D4CB4213841A1BD4 ccl21_human C-C motif chemokine 21 Small-inducible cytokine A21 Beta-chemokine exodus-2 6Ckine Secondary lymphoid-tissue chemokine CCL21 SCYA21 UNQ784/PRO1600 protein protein human Homo sapiens Human MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP FB48C2F71CB4A9D2 ccl21-ccr7-1 1 2 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction fig. 6c heparan sulfate