IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions human-a7 Human A7 melanoma cell line a7 A7 filamin-transfected sub-clone of M2, a human melanoma cell line lacking filamin fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling. Nat. Cell Biol. (1465-7392) 2006 imex curation Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis BioCreative - Critical Assessment of Information Extraction systems in Biology Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Ohta Y., Hartwig JH., Stossel TP. Apoptosis - Interactions involving proteins with a function related to apoptosis Species origin of ROCK1 assumed from previous work by contributing author yohta@rics.bwh.harvard.edu Accepted 2006-AUG-29 by DAVET. 24-JAN-2007: Contacted by JYOTI. human spleen cDNA Nat. Cell Biol. (1465-7392) 2006 Only protein-protein interactions imex curation cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 rhg24_human Rho GTPase-activating protein 24 Rho-type GTPase-activating protein 24 Filamin-A-associated RhoGAP RhoGAP of 73 kDa p73RhoGAP RAC1- and CDC42-specific GTPase-activating protein of 72 kDa Sarcoma antigen NY-SAR-88 ARHGAP24 FILGAP protein protein human Homo sapiens Human MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ 87A8E6DCA6869229 rock1_mouse Rho-associated protein kinase 1 Rho-associated, coiled-coil-containing protein kinase 1 p160 ROCK-1 Rock1 Rho-associated, coiled-coil-containing protein kinase I protein protein mouse Mus musculus Mouse MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANASENRSSSNVDKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNLKLDKIMKELDEEGNQRRNLESAVSQIEKEKMLLQHRINEYQRKVEQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKLTQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQADKDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVETEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLALQLEQESNKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAESEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTKDIEMLRKENEELNERMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS DIP protein P70335 original sequence version: 156 A1CBD543B831CF96 flna_human Filamin-A FLNA FLN FLN1 Alpha-filamin Filamin-1 Endothelial actin-binding protein Actin-binding protein 280 Non-muscle filamin protein protein human Homo sapiens Human MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP DIP protein P21333 original sequence version: 185 DIP protein P21333-1 original sequence version: 187 DIP protein P21333 original sequence version: 115 DIP protein P21333 original sequence version: 144 DIP protein P21333-1 original sequence version: 156 DIP protein P21333 original sequence version: 201 DIP protein P21333 original sequence version: 197 DIP protein P21333 original sequence version: 170 6C1A07041DF50142 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 arhgap24-flna-1 6 12 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association We isolated the full-length cDNA of a protein that was identified seven times as an interactor of the carboxyl terminus (repeats 21�24) of FLNa in a yeast two-hybrid screen of a human spleen cDNA library. arhgap24-flna-2 3 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 23 physical association physical association Domain boundaries (P21333) taken from Swiss-prot entry since not given in paper. 1C The ultimate C-terminal FLNa repeats (23�24) exhibited strong FilGAP binding activity. Repeat 23 alone had some binding activity, but repeat 24 had none (Fig. 1c). arhgap24-flna-3 4 10 unspecified role unspecified role bait bait coiled coil region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association 1E Endogenous FLNa associates with recombinant FilGAP in cells. Q8N264 transfection; arhgap24-flna-4 5 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1F Endogenous FilGAP associates with endogenous FLNa. arhgap24-cdc42-1 7 8 enzyme enzyme unspecified role unspecified role 10 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 13 enzyme target enzyme target substrate substrate unspecified role unspecified role physical association physical association 2A A GST fusion fragment of FilGAP encompassing amino acids 96-395 stimulates the intrinsic GTPase activity of both Cdc42 and Rac1 Phosphorylation of CDC42 arhgap24-rac1-1 7 13 enzyme target enzyme target substrate substrate unspecified role unspecified role 9 enzyme enzyme unspecified role unspecified role 10 unspecified role unspecified role ancillary ancillary region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 2A A GST fusion fragment of FilGAP encompassing amino acids 96-395 stimulates the intrinsic GTPase activity of both Cdc42 and Rac1 Phosphorylation of RAC1 arhgap24-flna-5 2 12 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain colocalization colocalization 3B Colocalisation of FilGAP and FLNa in lamellae of A7 cells is indicated in the merged image (yellow). Q8N264 transfection; arhgap24-roak1-1 1 11 enzyme enzyme unspecified role unspecified role 10 enzyme target enzyme target substrate substrate unspecified role unspecified role spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Table S2 To determine whether or not ROCK phosphorylates FilGAP in vitro, recombinant ROCK was incubatd with purified full-length FilGAP protein. Authors state data relevant to this assay is shown in Fig 5B but this is not the case, however supplementary Table S2 gives sites phosphorylated by in vitro assay. Phosphorylation of Ser-391, Ser-402, Ser-413, Ser-415, Ser-437, Thr-452, Ser-573, Ser-574, Thr-575, Thr-576 and Thr-577 arhgap24-flna-6 3 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Domain boundaries (P21333) taken from Swiss-prot entry since not given in paper. 1C The ultimate C-terminal FLNa repeats (23�24) exhibited strong FilGAP binding activity. Repeat 23 alone had some binding activity, but repeat 24 had none (Fig. 1c).