IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. J. Biol. Chem. (0021-9258) 1999 imex curation Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu Accepted 2006-JUN-6 by DAVET. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. J. Biol. Chem. (0021-9258) 1999 imex curation Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu Accepted 2006-JUN-6 by DAVET. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. J. Biol. Chem. (0021-9258) 1999 imex curation Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu Accepted 2006-JUN-6 by DAVET. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. J. Biol. Chem. (0021-9258) 1999 imex curation Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu Accepted 2006-JUN-6 by DAVET. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. The Cap-binding protein eIF4E promotes folding of a functional domain of yeast translation initiation factor eIF4G1. J. Biol. Chem. (0021-9258) 1999 imex curation Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro footprinting footprinting predetermined predetermined participant predetermined Hershey PE., McWhirter SM., Gross JD., Wagner G., Alber T., Sachs AB. BioCreative - Critical Assessment of Information Extraction systems in Biology Approximately 0.5 mg/ml eIF4G1381-506 + eIF4E in a 1:1 stoichiometric complex was degraded with trypsin. Products were resolved on a 12% SDS-PAGE gel and visualized by Coomassie Brilliant Blue staining. Determination of protected fragment boundaries was by mass spectrometry and microsequencing. asachs@uclink4.berkeley.edu Accepted 2006-JUN-6 by DAVET. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation if4e_yeast Eukaryotic translation initiation factor 4E CDC33 mRNA cap-binding protein eIF-4F 25 kDa subunit TIF45 YOL139C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVEEVSKKFEENVSVDDTTATPKTVLSDSAHFDVKHPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKWSFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKSEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGRHPQPSITL 5B9162E1BD0B1BDE 5B9162E1BD0B1BDE if4f1_yeast Eukaryotic initiation factor 4F subunit p150 YGR162W TIF4631 eIF4G1 mRNA cap-binding protein complex subunit p150 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTDETAHPTQSASKQESAALKQTGDDQQESQQQRGYTNYNNGSNYTQKKPYNSNRPHQQRGGKFGPNRYNNRGNYNGGGSFRGGHMGANSSNVPWTGYYNNYPVYYQPQQMAAAGSAPANPIPVEEKSPVPTKIEITTKSGEHLDLKEQHKAKLQSQERSTVSPQPESKLKETSDSTSTSTPTPTPSTNDSKASSEENISEAEKTRRNFIEQVKLRKAALEKKRKEQLEGSSGNNNIPMKTTPENVEEKGSDKPEVTEKTKPAEEKSAEPEVKQETPAEEGEQGEKGQIKEESTPKVLTFAERLKLKKQQKEREEKTEGKENKEVPVQEETKSAIESAPVPPSEQVKEETEVAETEQSNIDESATTPAIPTKSDEAEAEVEAEAGDAGTKIGLEAEIETTTDETDDGTNTVSHILNVLKDATPIEDVFSFNYPEGIEGPDIKYKKEHVKYTYGPTFLLQFKDKLNVKADAEWVQSTASKIVIPPGMGRGNRSRDSGRFGNNSSRGHDFRNTSVRNMDDRANSRTSSKRRSKRMNDDRRSNRSYTSRRDRERGSYRNEEKREDDKPKEEVAPLVPSANRWVPKFKSKKTEKKLAPDGKTELLDKDEVERKMKSLLNKLTLEMFDAISSEILAIANISVWETNGETLKAVIEQIFLKACDEPHWSSMYAQLCGKVVKELNPDITDETNEGKTGPKLVLHYLVARCHAEFDKGWTDKLPTNEDGTPLEPEMMSEEYYAAASAKRRGLGLVRFIGFLYRLNLLTGKMMFECFRRLMKDLTDSPSEETLESVVELLNTVGEQFETDSFRTGQATLEGSQLLDSLFGILDNIIQTAKISSRIKFKLIDIKELRHDKNWNSDKKDNGPKTIQQIHEEEERQRQLKNNSRSNSRRTNNSSNRHSFRRDAPPASKDSFITTRTYSQRNSQRAPPPKEEPAAPTSTATNMFSALMGESDDEE 391256802F86118E 391256802F86118E tif4631-tif45-1 5 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association 1 The protection of these residues from digestion in the presence but not the absence of eIF4E indicated that they become inaccessible upon the formation of the eIF4G-eIF4E complex. tif4631-tif45-2 1 6 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence MS/MS certain certain sequence position certain certain certain sequence position certain region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 2 eIF4G1393-490 exists as an unfolded protein in the absence of eIF4E and becomes folded in the presence of eIF4E. Only the nmr spectra of TIF4631 was measured. This was shown to be unstructured in the absence of TIF45 and folded in the presence of TIF45 which was taken by the suthor as experimental evidence of an interaction. tif4631-tif45-3 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E D Wed May 02 17:27:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu425asp' Tue Jun 30 19:42:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu425Asp' P39935:p.Lys444Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:04:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys444ala' Tue Jun 30 17:14:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys444Ala' P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Thu Jul 07 12:16:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu457ala_leu458ala Fri Jul 22 11:04:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu457ala,leu458ala' Wed May 02 17:15:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu457-458ala_ala' Tue Jun 30 20:10:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu457_Leu458delinsAlaAla' physical association physical association 5a Co-immunoprecipitation of eIF4E with HA epitope-tagged eIF4G from crude lysates has been shown to be sensitive to mutations that disrupt this interaction. tif4631-tif45-4 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E D Wed May 02 14:58:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu425asp' Tue Jun 30 17:37:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu425Asp' P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Thu Jul 07 12:16:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu457ala_leu458ala Fri Jul 22 11:12:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu457ala,leu458ala' Wed May 02 16:55:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu457-458ala_ala' Tue Jun 30 18:41:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu457_Leu458delinsAlaAla' ecobb Escherichia coli (strain B / BL21) physical association physical association 5b binding of recombinant eIF4E to immobilized GST-eIF4G1 fusion proteins. tif4631-tif45-5 3 7 unspecified role unspecified role prey prey P39935:p.Glu425Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E D Wed May 02 17:40:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu425asp' Tue Jun 30 18:27:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu425Asp' P39935:p.Lys444Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:55:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys444ala' Tue Jun 30 16:47:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys444Ala' P39935:p.Leu457_Leu458delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain LL AA Thu Jul 07 12:07:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu457ala_leu458ala Fri Jul 22 10:58:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu457ala,leu458ala' Wed May 02 17:03:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu457-458ala_ala' Tue Jun 30 20:05:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu457_Leu458delinsAlaAla' n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 6 unspecified role unspecified role bait bait direct interaction direct interaction 5c Far Western analysis has also been used to examine the ability of eIF4G1 to bind to eIF4E