mpidb The Microbial Protein Interaction Database steen-2009-1 The putative coupling protein TcpA interacts with other pCW3-encoded proteins to form an essential part of the conjugation complex. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Steen J.A., Bannam T.L., Teng W.L., Devenish R.J., Rood J.I. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation steen-2009-2 The putative coupling protein TcpA interacts with other pCW3-encoded proteins to form an essential part of the conjugation complex. in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Steen J.A., Bannam T.L., Teng W.L., Devenish R.J., Rood J.I. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation steen-2009-3 The putative coupling protein TcpA interacts with other pCW3-encoded proteins to form an essential part of the conjugation complex. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag perox activity tag visualisation by peroxidase activity tag perox activity Steen J.A., Bannam T.L., Teng W.L., Devenish R.J., Rood J.I. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation q1plh8_clopf pCW3_0032 tcpC G6Z03_15175 protein protein clostridium perfring Clostridium perfringens MFRKNKENTKPKKEKKEKKSFFKKKDKLNMDLEDSVANLDKQVNGVKEKKLVSVMPFRIARAFIWVLIGILCFRGGVSVFKGNQSEALKKENEKILNNMEKQSSLETQAFSFAEEFAWDYFSRYPSDTQDFVRRITKYTTEQLANEMNNGTYSDVIYTSAFYFEKYSENQVNVSVKARVRVYTPKAGQEQTPQDQLQYDTNLVDYYLEVPIVFDKDMNMAVDALPVMTAPPEKAYFKNKEFSGTSENDADKTKKITDSVSQFFKAYYEQNQTQIDYFLVDGADIKGAGQKFSFNKIDRINIYKLSDKEFLAIVDLNVDSFGNAIKQGFNLTVVQEGDKFLVKTLEPRTSNIDLNNKSNN q1pli0_clopf pCW3_0030 tcpA protein protein clostridium perfring Clostridium perfringens MIFLSSDWEKKVNQEIENGANAIINEIANVLRIFFFRVGLGFKKSWKNKKLFIGFFLSFLIPIAARIKSDYFLVDTKFYFKIIYFLTFIAPLFYMVIVSFVKNKEDKRNAEYRLAFEQLNFVGADSKTPILKSFIEDKGTRIDEITFESMIPIETWKSYIPQLQTSLNISIISIEQGASKRIVIIKSMAGDAKIPKYLPWDDKYIEEQEGVVVVGQTFSGNIKIDLNKSPHILSAGETGSGKSVILRCILWQLLKQGAIAYMVDFKGGVEFGLEYEKVGQVITEVDAAEKLFKYLVDENAKRLKLLRESGSKNIGEYNKKFEGEELKRIIVVIDELAELMDKTGVDDETRAKLVRIEGYTSTLARLSRATGINLCIGVQRPDAKVITGQIKNNVPVRICGRFADSKASEIVLSNTKAKDLPEVKGRFLFKLGADTVQFQAFYFDDDKHFIPNKILKLRKDEIEDKKVGLDLNKEKLIDNDLMNSVNEKFEIKEVKSMDSNIENEDDSKFENFEEQNKTENLKSTINDDYE q1plh3_clopf ERS852446_03029 pCW3_0037 tcpH pTet_030 G6Z03_15150 protein protein clostridium perfring Clostridium perfringens MENVKINIYSKFLYLKNKLTYKNILKAIVIIATIVIAYNCLTKIAYADGFLSYGNSDDPYKNIPEGWGMFISEKYRNNYALDIIDTHGWELIDKAITGLTNIVFSGIVMISWFGVNIFRFCFTNDIAAGFANQLNSVLGSLNNGIFNNFFMIVFMISLFSIVYNLYKKNFSAIGSQILAVAIIYATTAFLSNGAVGFLSKTTEFSKTIGTSAIVAINGKDNNEGSLEDYSKTVVGTLWGNFVQQPWVMLEFDGKVPLNDENMTTKNSINEEALNYSKDILSEPYGSDEREKALESINEKFNKELFSKNGINTKLVSVCVLFVITLIKMIILIAVGMIQIGFQLMSILLILLLPFIMLIAIVPFFGGTNIIKGIARKYLGTQLGIIVSSFVLALLVLVDTVTLTMFQAWGANLIIALLMQCTCWIMVIAFRKQLMNGLINLQNRIAPGTAGAFRFGAKPLDKGADIAKEYAVNPAMDRAYDIGDNLITKAQYAKEYTKGNLSLYKDRKVAQAIDFLGSKYDNLKNNKPEDIENANNPKENIDGVKDTKNKVNSNENINKKPVEKFDLNGVKATKPSNITSENIPNKNINGENKPNIDEDAVTKNDIKDPIENKDIAPKTIDENIKNNGNDNGTIQDKSPGSKENKTISEDEEITTKPEEIKTPEKTINKENLNELKNENTSADKKNNDSNSSNISVTEIPEDLVEEKSVEAINKAKNDVKANKEKINNNINSKNVESNPEVKENIEVASSPEVTEIKKKSTKKVENIKNNGQPKEKSADKKEIKEVSTKERVERVKSFMGVSNKDIKSKEKHLENKLEYIKKGNSKNFKKKGS q1plh4_clopf pCW3_0036 tcpG G6Z03_15155 protein protein clostridium perfring Clostridium perfringens MKKLFIWSGIISLIFPLLFFFLIIGGSGEQPTPVNPNPNLTEEQLNFISQIVSGAKQSYEETGIFPSITLAQAILESGWGRSGLAIKANNLFGIKADSGWKGKVLEMPTQEHVNGGIITIIARWRVYESWNESVIDHGKFFVENSRYKENGVLDAKNYVEQAQCIQKAGYATDPNYANQLIQVINDFGLNLYDMNGDVVGNDVIEKAIEAGMKWVGKSPYVWGGGRNQADVDAGRFDCSSLVHYCYASAGIQLGPRESVTTWSLINMGKPVPASEMKRGDLIFFDTAGRNGHIGIYLGNGKFLNDSSTQGVSIGDLNSAYWSRYFNGNVRRVVE tcpc-tcpc-2 1335520 not-defined-215082983 1335523 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-327787848 1335523 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 2 tcpa-tcph-1 1335520 not-defined-721251951 1335524 unspecified role unspecified role bait bait Q1PLI0:p.Asp334_Glu335delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1653051966 1335525 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1, 4E tcpa-tcpg 1335520 not-defined-1117670580 1335524 unspecified role unspecified role bait bait Q1PLI0:p.Asp334_Glu335delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q1PLI0:p.Gln379Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false not-defined-128819501 1335526 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1, 4D tcpa-tcpc 1335520 not-defined-529818609 1335523 unspecified role unspecified role prey prey not-defined-1445242988 1335524 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q1PLI0:p.Asp334_Glu335delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1, 4C tcpa-tcpa 1335520 not-defined-1886358144 1335524 unspecified role unspecified role prey prey not-defined-1050645870 1335524 unspecified role unspecified role bait bait Q1PLI0:p.Asp334_Glu335delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1, 4B tcpg-tcpg-1 1335520 not-defined-570806426 1335526 unspecified role unspecified role prey prey not-defined-1215303517 1335526 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1B tcpg-tcpg-2 1335521 not-defined-582832602 1335526 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1443149682 1335526 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2 tcpc-tcpc-1 1335521 not-defined-327787848 1335523 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-215082983 1335523 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2 tcpa-tcpa-2 1335521 not-defined-1886358144 1335524 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1050645870 1335524 unspecified role unspecified role neutral component neutral component region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2 tcpa-tcph-2 1335522 not-defined-721251951 1335524 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1653051966 1335525 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 3