IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lee-2006c-1 Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. rat-rin_5f Rattus norvegicus rin_5f Rat islet cell tumour anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation lee-2006c-2 Neuroendocrine protein 7B2 can be inactivated by phosphorylation within the secretory pathway. mouse-att_20 Mus musculus att_20 Mouse pituitary tumour anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Lee SN., Hwang JR., Lindberg I. BioCreative - Critical Assessment of Information Extraction systems in Biology Rat Rin-5F cell line transformed with rat proenkephalin (P04094) and rat 7B2 (P27682) was used in this study. ilindb@Isuhsc.edu J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation 7b2_rat Neuroendocrine protein 7B2 Secretory granule endocrine protein I Secretogranin-5 Secretogranin V Scg5 Sgne1 protein protein rat Rattus norvegicus (Rat) Rat MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE nec2_rat Neuroendocrine convertase 2 Prohormone convertase 2 Proprotein convertase 2 KEX2-like endoprotease 2 Pcsk2 Nec2 Nec-2 Rpc2 protein protein rat Rattus norvegicus (Rat) Rat MEGGCGSQWKAAGLLFCVMVFASAERPVFTNHFLVELHKDGEEEARQVAAEHGFGVRKLPFAEGLYHFYHNGLAKAKRRRSLHHKRQLERDPRIKMALQQEGFDRKKRGYRDINEIDINMNDPLFTKQWYLFNTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLAYNYNSDASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAASNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANVDLTWRDMQHLTVLTSKRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQNPEKIPPTGKLVLTLQTNACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRPRDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGLLKEWTLMLHGTQSAPYIDQVVRDYQSKLAMSKKQELEEELDEAVERSLQSILRKN scg5-pcsk2 Interaction between Scg5 and Pcsk2 504807 N/A 504809 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 504810 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2A The authors concluded that non-phosphorylated 7B2 protein coimmunoprecipitated with PC2 protein. pcsk2-scg5 Interaction between Pcsk2 and Scg5 504807 N/A 504810 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 504809 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2A scg5-pcsk2-1 Interaction between Scg5 and Pcsk2 504808 N/A 504809 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 504810 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2A The authors concluded that non-phosphorylated 7B2 protein coimmunoprecipitated with PC2 protein. pcsk2-scg5-1 Interaction between Pcsk2 and Scg5 504808 N/A 504809 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 504810 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 2A