UniProt UniProt http://www.uniprot.org bichsel-2004-1 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation bichsel-2004-2 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology GST-fused MOBK1B was added to bacterial expressed SHP-fused STK38L and autophosphorylation assays were performed using phosphospecific antibodies. brian.hemming@fmi.ch J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation bichsel-2004-3 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation mob1a_human MOB kinase activator 1A MOB1A C2orf6 MOB4B MOBK1B MOBKL1B Mob1 alpha Mob1 homolog 1B Mps one binder kinase activator-like 1B protein protein human Homo sapiens Human MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR stk38_human Serine/threonine-protein kinase 38 NDR1 STK38 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein human Homo sapiens Human MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK st38l_human Serine/threonine-protein kinase 38-like NDR2 protein kinase Nuclear Dbf2-related kinase 2 STK38L KIAA0965 NDR2 protein protein human Homo sapiens Human MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL stk38-mobk1b-1 505908 N/A 505911 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 505912 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q15208:p.Arg41Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q15208:p.Tyr31Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q15208:p.Thr74Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q15208:p.Arg78Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false Q15208:p.Lys24Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q15208:p.Arg44Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q15208:p.Leu79Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association false false false 2A, 2C and 4 Interaction was increased in OA (okadaic acid) treated cells. Cos1 cells have been transfected with MOBk1B and STK38 and have been treated with OA (okadaic acid) prior to lysis. Alternatively, Cos1 cells have been transfected separately, treated with OA prior to lysis and lysates have neen combined. Interaction heas been observed independent of OA-treatment of STK38/NDR1-transfected cells. Kinase-dead STK38 mutant lys118ala showed interaction in OA-treated cells. mobk1b-stk38-1 505908 N/A 505911 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 505912 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association false false false 2B Interaction was increased in OA (okadaic acid) treated cells. Cos1 cells have been transfected with MOBk1B and STK38 and have been treates with OA (okadaic acid) prior to lysis. stk38l-stk38l-1 505909 n/a 505913 putative self putative self putative self putative self region SHP fusion protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false true false Autophosphorylation of STK38L at sites Thr-75 and Ser-282. Autophosphorylation was stimulated by presence of MOBK1B (UniProt Ac: Q9H8S9) 1B stk38l-mobk1b-1 505910 N/A 505913 unspecified role unspecified role prey prey Q9Y2H1:p.Tyr32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region SHP (capsid-stabilizing protein of lambdoid phage 21) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 505911 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 5B