Cdd ::= { name "TRX_superfamily", id { gid { accession "cd01659", version 1 }, uid 48494 }, description { comment "Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others.", comment "linked to 3D-structure", source "Pfam", create-date std { year 2003, month 12, day 12 }, source-id { gid { accession "pfam00085", version 0 } }, curation-status iav2, old-root { gid { accession "cd01659", version 1 } }, update-date std { year 2008, month 1, day 9, hour 14, minute 56, second 56 }, update-date std { year 2004, month 11, day 30 }, update-date std { year 2005, month 1, day 21 }, reference pmid 15558583, update-date std { year 2005, month 2, day 18 }, reference pmid 15340164, reference pmid 10049365, reference pmid 15675892, reference pmid 15518547, reference pmid 14713336, reference pmid 12524212, reference pmid 12196152, reference pmid 10085220, reference pmid 11702225, reference pmid 9099998, reference pmid 11237106, reference pmid 14503871, reference pmid 7788290, status finished-ok, tax-source { taxname "cellular organisms", db { { db "taxon", tag id 131567 } }, syn { "biota" }, orgname { name partial { { fixed-level other, level "no rank", name "cellular organisms" } }, gcode 1, div "UNA" } } }, seqannot { { data align { { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 0, 23 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 11, 34 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 30, 54 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 54, 75 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 65, 87 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "2TRX", chain 65 } }, starts { 67, 89 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 0, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 11, 38 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 30, 61 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 54, 82 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 65, 96 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1MEK" } }, starts { 67, 98 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2501208 }, starts { 0, 49 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501208 }, starts { 11, 63 }, len 3 }, { dim 2, ids { local str "consensus", gi 2501208 }, starts { 30, 81 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501208 }, starts { 54, 105 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501208 }, starts { 65, 119 }, len 2 }, { dim 2, ids { local str "consensus", gi 2501208 }, starts { 67, 121 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 0, 25 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 11, 37 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 30, 56 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 54, 79 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 65, 91 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1A8L" } }, starts { 67, 93 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 0, 147 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 11, 159 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 30, 175 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 54, 192 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 65, 205 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 67, 207 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 0, 250 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 11, 265 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 30, 283 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 54, 309 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 65, 322 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 67, 324 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 0, 33 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 11, 54 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 30, 71 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 54, 92 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 65, 103 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } } }, starts { 67, 105 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 0, 136 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 11, 147 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 30, 166 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 54, 186 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 65, 198 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1B9Y", chain 67 } }, starts { 67, 200 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 0, 2 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 54, 54 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 65, 61 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1BYE", chain 68 } }, starts { 67, 63 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 0, 21 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 11, 32 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 30, 55 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 54, 150 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 65, 158 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1DSB", chain 65 } }, starts { 67, 160 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 0, 8 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 11, 19 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 30, 33 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 54, 60 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 65, 67 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1E6B", chain 65 } }, starts { 67, 69 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 0, 89 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 11, 100 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 30, 117 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 54, 182 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 65, 190 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1EEJ", chain 65 } }, starts { 67, 192 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 0, 23 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 11, 34 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 30, 48 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 54, 72 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 65, 80 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1EEM", chain 65 } }, starts { 67, 82 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 0, 0 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 11, 10 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 30, 24 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 54, 52 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 65, 60 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1F2E", chain 68 } }, starts { 67, 62 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 0, 5 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 11, 16 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 30, 36 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 54, 57 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 65, 64 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1FO5", chain 65 } }, starts { 67, 66 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 0, 511 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 11, 523 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 30, 557 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 54, 612 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 65, 625 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } } }, starts { 67, 627 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 0, 2 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 54, 52 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 65, 59 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1FOV", chain 65 } }, starts { 67, 61 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 0, 20 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 11, 31 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 30, 45 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 54, 72 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 65, 82 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1G6Y", chain 66 } }, starts { 67, 84 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 0, 24 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 11, 33 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 30, 55 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 54, 83 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 65, 97 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 67, 99 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 0, 0 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 11, 11 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 30, 25 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 54, 48 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 65, 56 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } } }, starts { 67, 58 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 0, 36 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 11, 47 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 30, 68 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 54, 159 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 65, 172 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1GP1", chain 65 } }, starts { 67, 174 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 11, 14 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 30, 28 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 54, 54 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 65, 61 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1GSE", chain 66 } }, starts { 67, 63 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 0, 2 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 54, 51 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 65, 58 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1H75", chain 65 } }, starts { 67, 60 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 0, 120 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 11, 131 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 30, 150 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 54, 171 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 65, 178 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 67, 180 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 0, 22 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 11, 32 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 30, 51 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 54, 62 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 65, 74 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } } }, starts { 67, 76 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 0, 2 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 54, 50 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 65, 57 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1IYI", chain 68 } }, starts { 67, 59 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 11, 14 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 30, 28 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 54, 94 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 65, 101 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1J9B", chain 65 } }, starts { 67, 103 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 0, 63 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 11, 74 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 30, 95 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 54, 144 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 65, 157 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1JFU", chain 65 } }, starts { 67, 159 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 0, 7 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 11, 26 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 30, 40 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 54, 64 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 65, 71 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } } }, starts { 67, 73 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 0, 45 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 11, 56 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 30, 74 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 54, 118 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 65, 131 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1KNG", chain 65 } }, starts { 67, 133 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 0, 13 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 11, 24 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 30, 41 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 54, 69 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 65, 76 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1KTE" } }, starts { 67, 78 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 0, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 11, 38 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 30, 57 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 54, 100 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 65, 112 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1LU4", chain 65 } }, starts { 67, 114 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 0, 5 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 11, 21 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 30, 49 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 54, 62 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 65, 71 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } } }, starts { 67, 73 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 54, 49 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 65, 57 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } } }, starts { 67, 59 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 0, 171 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 11, 182 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 30, 196 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 54, 220 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 65, 227 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1NM3", chain 66 } }, starts { 67, 229 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 0, 31 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 11, 42 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 30, 64 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 54, 109 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 65, 123 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1O73", chain 65 } }, starts { 67, 125 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 0, 45 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 11, 57 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 30, 80 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 54, 137 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 65, 149 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } } }, starts { 67, 151 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 0, 36 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 11, 48 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 30, 71 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 54, 136 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 65, 149 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1ON4", chain 65 } }, starts { 67, 151 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 0, 6 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 11, 17 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 30, 31 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 54, 56 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 65, 63 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1OYJ", chain 68 } }, starts { 67, 65 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 0, 34 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 11, 46 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 30, 67 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 54, 131 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 65, 144 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1PRX", chain 65 } }, starts { 67, 146 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 0, 45 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 11, 57 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 30, 76 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 54, 126 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 65, 139 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1PSQ", chain 66 } }, starts { 67, 141 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 0, 26 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 11, 37 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 30, 57 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 54, 78 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 65, 91 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } } }, starts { 67, 101 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 0, 37 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 11, 49 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 30, 70 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 54, 125 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 65, 138 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1QMV", chain 65 } }, starts { 67, 140 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 0, 7 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 11, 18 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 30, 36 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 54, 183 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 65, 194 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1R4W", chain 65 } }, starts { 67, 196 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 0, 1 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 11, 12 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 30, 26 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 54, 91 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 65, 98 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1RW1", chain 65 } }, starts { 67, 100 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 0, 49 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 11, 60 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 30, 82 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 54, 104 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 65, 119 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1SEN", chain 65 } }, starts { 67, 130 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 11, 20 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 30, 34 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 54, 61 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 65, 68 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1T1V", chain 66 } }, starts { 67, 70 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 0, 14 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 11, 24 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 30, 46 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 54, 67 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 65, 78 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 67, 80 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 0, 31 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 11, 42 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 30, 64 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 54, 89 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 65, 104 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1UC7", chain 65 } }, starts { 67, 106 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 0, 0 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 11, 11 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 30, 25 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 54, 51 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 65, 58 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1V2A", chain 68 } }, starts { 67, 60 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 0, 16 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 11, 32 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 30, 46 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 54, 71 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 65, 78 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } } }, starts { 67, 80 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 0, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 11, 45 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 30, 65 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 54, 93 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 65, 102 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } } }, starts { 67, 104 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 0, 39 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 11, 51 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 30, 72 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 54, 122 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 65, 135 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1XVW", chain 66 } }, starts { 67, 137 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 0, 1 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 11, 12 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 30, 26 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 54, 59 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 65, 66 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1XW5", chain 66 } }, starts { 67, 68 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 0, 10 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 11, 21 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 30, 35 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 54, 59 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 65, 66 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } } }, starts { 67, 68 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 0, 14 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 11, 25 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 30, 39 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 54, 61 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 65, 72 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "1Z9H", chain 68 } }, starts { 67, 74 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 0, 21 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 11, 33 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 30, 48 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 54, 65 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 65, 78 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } } }, starts { 67, 80 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 0, 2 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 11, 13 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 54, 54 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 65, 61 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "3LJR", chain 66 } }, starts { 67, 63 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 11, 14 }, len 3 }, { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 30, 28 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 54, 53 }, len 6 }, { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 65, 60 }, len 2 }, { dim 2, ids { local str "consensus", pdb { mol "3PGT", chain 66 } }, starts { 67, 62 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 119530 }, starts { 0, 307 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 11, 319 }, len 3 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 30, 335 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 54, 352 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 65, 364 }, len 2 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 67, 366 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 119530 }, starts { 0, 414 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 11, 434 }, len 3 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 30, 449 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 54, 474 }, len 6 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 65, 485 }, len 2 }, { dim 2, ids { local str "consensus", gi 119530 }, starts { 67, 487 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 123467 }, starts { 0, 71 }, len 6 }, { dim 2, ids { local str "consensus", gi 123467 }, starts { 11, 79 }, len 3 }, { dim 2, ids { local str "consensus", gi 123467 }, starts { 30, 110 }, len 6 }, { dim 2, ids { local str "consensus", gi 123467 }, starts { 54, 123 }, len 6 }, { dim 2, ids { local str "consensus", gi 123467 }, starts { 65, 130 }, len 2 }, { dim 2, ids { local str "consensus", gi 123467 }, starts { 67, 132 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 126289 }, starts { 0, 6 }, len 6 }, { dim 2, ids { local str "consensus", gi 126289 }, starts { 11, 23 }, len 3 }, { dim 2, ids { local str "consensus", gi 126289 }, starts { 30, 37 }, len 6 }, { dim 2, ids { local str "consensus", gi 126289 }, starts { 54, 59 }, len 6 }, { dim 2, ids { local str "consensus", gi 126289 }, starts { 65, 66 }, len 2 }, { dim 2, ids { local str "consensus", gi 126289 }, starts { 67, 68 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 464973 }, starts { 0, 60 }, len 6 }, { dim 2, ids { local str "consensus", gi 464973 }, starts { 11, 71 }, len 3 }, { dim 2, ids { local str "consensus", gi 464973 }, starts { 30, 91 }, len 6 }, { dim 2, ids { local str "consensus", gi 464973 }, starts { 54, 114 }, len 6 }, { dim 2, ids { local str "consensus", gi 464973 }, starts { 65, 127 }, len 2 }, { dim 2, ids { local str "consensus", gi 464973 }, starts { 67, 129 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 643639 }, starts { 0, 6 }, len 6 }, { dim 2, ids { local str "consensus", gi 643639 }, starts { 11, 17 }, len 3 }, { dim 2, ids { local str "consensus", gi 643639 }, starts { 30, 31 }, len 6 }, { dim 2, ids { local str "consensus", gi 643639 }, starts { 54, 58 }, len 6 }, { dim 2, ids { local str "consensus", gi 643639 }, starts { 65, 65 }, len 2 }, { dim 2, ids { local str "consensus", gi 643639 }, starts { 67, 67 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 707001 }, starts { 0, 119 }, len 6 }, { dim 2, ids { local str "consensus", gi 707001 }, starts { 11, 131 }, len 3 }, { dim 2, ids { local str "consensus", gi 707001 }, starts { 30, 157 }, len 6 }, { dim 2, ids { local str "consensus", gi 707001 }, starts { 54, 170 }, len 6 }, { dim 2, ids { local str "consensus", gi 707001 }, starts { 65, 186 }, len 2 }, { dim 2, ids { local str "consensus", gi 707001 }, starts { 67, 188 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 729442 }, starts { 0, 49 }, len 6 }, { dim 2, ids { local str "consensus", gi 729442 }, starts { 11, 60 }, len 3 }, { dim 2, ids { local str "consensus", gi 729442 }, starts { 30, 82 }, len 6 }, { dim 2, ids { local str "consensus", gi 729442 }, starts { 54, 103 }, len 6 }, { dim 2, ids { local str "consensus", gi 729442 }, starts { 65, 116 }, len 2 }, { dim 2, ids { local str "consensus", gi 729442 }, starts { 67, 118 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 731924 }, starts { 0, 5 }, len 6 }, { dim 2, ids { local str "consensus", gi 731924 }, starts { 11, 15 }, len 3 }, { dim 2, ids { local str "consensus", gi 731924 }, starts { 30, 29 }, len 6 }, { dim 2, ids { local str "consensus", gi 731924 }, starts { 54, 56 }, len 6 }, { dim 2, ids { local str "consensus", gi 731924 }, starts { 65, 69 }, len 2 }, { dim 2, ids { local str "consensus", gi 731924 }, starts { 67, 71 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 1652910 }, starts { 0, 74 }, len 6 }, { dim 2, ids { local str "consensus", gi 1652910 }, starts { 11, 85 }, len 3 }, { dim 2, ids { local str "consensus", gi 1652910 }, starts { 30, 106 }, len 6 }, { dim 2, ids { local str "consensus", gi 1652910 }, starts { 54, 177 }, len 6 }, { dim 2, ids { local str "consensus", gi 1652910 }, starts { 65, 190 }, len 2 }, { dim 2, ids { local str "consensus", gi 1652910 }, starts { 67, 192 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 1731272 }, starts { 0, 428 }, len 6 }, { dim 2, ids { local str "consensus", gi 1731272 }, starts { 11, 439 }, len 3 }, { dim 2, ids { local str "consensus", gi 1731272 }, starts { 30, 460 }, len 6 }, { dim 2, ids { local str "consensus", gi 1731272 }, starts { 54, 508 }, len 6 }, { dim 2, ids { local str "consensus", gi 1731272 }, starts { 65, 521 }, len 2 }, { dim 2, ids { local str "consensus", gi 1731272 }, starts { 67, 523 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2208861 }, starts { 0, 98 }, len 6 }, { dim 2, ids { local str "consensus", gi 2208861 }, starts { 11, 109 }, len 3 }, { dim 2, ids { local str "consensus", gi 2208861 }, starts { 30, 128 }, len 6 }, { dim 2, ids { local str "consensus", gi 2208861 }, starts { 54, 218 }, len 6 }, { dim 2, ids { local str "consensus", gi 2208861 }, starts { 65, 233 }, len 2 }, { dim 2, ids { local str "consensus", gi 2208861 }, starts { 67, 235 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2497800 }, starts { 0, 81 }, len 6 }, { dim 2, ids { local str "consensus", gi 2497800 }, starts { 11, 92 }, len 3 }, { dim 2, ids { local str "consensus", gi 2497800 }, starts { 30, 110 }, len 6 }, { dim 2, ids { local str "consensus", gi 2497800 }, starts { 54, 151 }, len 6 }, { dim 2, ids { local str "consensus", gi 2497800 }, starts { 65, 164 }, len 2 }, { dim 2, ids { local str "consensus", gi 2497800 }, starts { 67, 166 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2501204 }, starts { 0, 50 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501204 }, starts { 11, 61 }, len 3 }, { dim 2, ids { local str "consensus", gi 2501204 }, starts { 30, 81 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501204 }, starts { 54, 104 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501204 }, starts { 65, 133 }, len 2 }, { dim 2, ids { local str "consensus", gi 2501204 }, starts { 67, 135 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2501205 }, starts { 0, 46 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 11, 57 }, len 3 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 30, 77 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 54, 98 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 65, 111 }, len 2 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 67, 113 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2501205 }, starts { 0, 304 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 11, 316 }, len 3 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 30, 331 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 54, 356 }, len 6 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 65, 366 }, len 2 }, { dim 2, ids { local str "consensus", gi 2501205 }, starts { 67, 368 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2507460 }, starts { 0, 388 }, len 6 }, { dim 2, ids { local str "consensus", gi 2507460 }, starts { 11, 399 }, len 3 }, { dim 2, ids { local str "consensus", gi 2507460 }, starts { 30, 421 }, len 6 }, { dim 2, ids { local str "consensus", gi 2507460 }, starts { 54, 440 }, len 6 }, { dim 2, ids { local str "consensus", gi 2507460 }, starts { 65, 454 }, len 2 }, { dim 2, ids { local str "consensus", gi 2507460 }, starts { 67, 456 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 2582822 }, starts { 0, 204 }, len 6 }, { dim 2, ids { local str "consensus", gi 2582822 }, starts { 11, 215 }, len 3 }, { dim 2, ids { local str "consensus", gi 2582822 }, starts { 30, 235 }, len 6 }, { dim 2, ids { local str "consensus", gi 2582822 }, starts { 54, 259 }, len 6 }, { dim 2, ids { local str "consensus", gi 2582822 }, starts { 65, 271 }, len 2 }, { dim 2, ids { local str "consensus", gi 2582822 }, starts { 67, 273 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 3170570 }, starts { 0, 5 }, len 6 }, { dim 2, ids { local str "consensus", gi 3170570 }, starts { 11, 16 }, len 3 }, { dim 2, ids { local str "consensus", gi 3170570 }, starts { 30, 38 }, len 6 }, { dim 2, ids { local str "consensus", gi 3170570 }, starts { 54, 183 }, len 6 }, { dim 2, ids { local str "consensus", gi 3170570 }, starts { 65, 193 }, len 2 }, { dim 2, ids { local str "consensus", gi 3170570 }, starts { 67, 195 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 3724143 }, starts { 0, 83 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724143 }, starts { 11, 91 }, len 3 }, { dim 2, ids { local str "consensus", gi 3724143 }, starts { 30, 122 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724143 }, starts { 54, 135 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724143 }, starts { 65, 142 }, len 2 }, { dim 2, ids { local str "consensus", gi 3724143 }, starts { 67, 144 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 3724144 }, starts { 0, 6 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724144 }, starts { 11, 14 }, len 3 }, { dim 2, ids { local str "consensus", gi 3724144 }, starts { 30, 39 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724144 }, starts { 54, 52 }, len 6 }, { dim 2, ids { local str "consensus", gi 3724144 }, starts { 65, 63 }, len 2 }, { dim 2, ids { local str "consensus", gi 3724144 }, starts { 67, 65 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 5453541 }, starts { 0, 72 }, len 6 }, { dim 2, ids { local str "consensus", gi 5453541 }, starts { 11, 83 }, len 3 }, { dim 2, ids { local str "consensus", gi 5453541 }, starts { 30, 103 }, len 6 }, { dim 2, ids { local str "consensus", gi 5453541 }, starts { 54, 125 }, len 6 }, { dim 2, ids { local str "consensus", gi 5453541 }, starts { 65, 140 }, len 2 }, { dim 2, ids { local str "consensus", gi 5453541 }, starts { 67, 150 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 5916091 }, starts { 0, 70 }, len 6 }, { dim 2, ids { local str "consensus", gi 5916091 }, starts { 11, 81 }, len 3 }, { dim 2, ids { local str "consensus", gi 5916091 }, starts { 30, 99 }, len 6 }, { dim 2, ids { local str "consensus", gi 5916091 }, starts { 54, 242 }, len 6 }, { dim 2, ids { local str "consensus", gi 5916091 }, starts { 65, 260 }, len 2 }, { dim 2, ids { local str "consensus", gi 5916091 }, starts { 67, 262 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 6136668 }, starts { 0, 103 }, len 6 }, { dim 2, ids { local str "consensus", gi 6136668 }, starts { 11, 114 }, len 3 }, { dim 2, ids { local str "consensus", gi 6136668 }, starts { 30, 133 }, len 6 }, { dim 2, ids { local str "consensus", gi 6136668 }, starts { 54, 154 }, len 6 }, { dim 2, ids { local str "consensus", gi 6136668 }, starts { 65, 166 }, len 2 }, { dim 2, ids { local str "consensus", gi 6136668 }, starts { 67, 168 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 6840947 }, starts { 0, 34 }, len 6 }, { dim 2, ids { local str "consensus", gi 6840947 }, starts { 11, 45 }, len 3 }, { dim 2, ids { local str "consensus", gi 6840947 }, starts { 30, 64 }, len 6 }, { dim 2, ids { local str "consensus", gi 6840947 }, starts { 54, 85 }, len 6 }, { dim 2, ids { local str "consensus", gi 6840947 }, starts { 65, 97 }, len 2 }, { dim 2, ids { local str "consensus", gi 6840947 }, starts { 67, 99 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 6911877 }, starts { 0, 269 }, len 6 }, { dim 2, ids { local str "consensus", gi 6911877 }, starts { 11, 286 }, len 3 }, { dim 2, ids { local str "consensus", gi 6911877 }, starts { 30, 300 }, len 6 }, { dim 2, ids { local str "consensus", gi 6911877 }, starts { 54, 329 }, len 6 }, { dim 2, ids { local str "consensus", gi 6911877 }, starts { 65, 336 }, len 2 }, { dim 2, ids { local str "consensus", gi 6911877 }, starts { 67, 338 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 7705726 }, starts { 0, 158 }, len 6 }, { dim 2, ids { local str "consensus", gi 7705726 }, starts { 11, 169 }, len 3 }, { dim 2, ids { local str "consensus", gi 7705726 }, starts { 30, 190 }, len 6 }, { dim 2, ids { local str "consensus", gi 7705726 }, starts { 54, 217 }, len 6 }, { dim 2, ids { local str "consensus", gi 7705726 }, starts { 65, 234 }, len 2 }, { dim 2, ids { local str "consensus", gi 7705726 }, starts { 67, 236 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 11135548 }, starts { 0, 1 }, len 6 }, { dim 2, ids { local str "consensus", gi 11135548 }, starts { 11, 12 }, len 3 }, { dim 2, ids { local str "consensus", gi 11135548 }, starts { 30, 26 }, len 6 }, { dim 2, ids { local str "consensus", gi 11135548 }, starts { 54, 92 }, len 6 }, { dim 2, ids { local str "consensus", gi 11135548 }, starts { 65, 99 }, len 2 }, { dim 2, ids { local str "consensus", gi 11135548 }, starts { 67, 101 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 14017877 }, starts { 0, 76 }, len 6 }, { dim 2, ids { local str "consensus", gi 14017877 }, starts { 11, 87 }, len 3 }, { dim 2, ids { local str "consensus", gi 14017877 }, starts { 30, 110 }, len 6 }, { dim 2, ids { local str "consensus", gi 14017877 }, starts { 54, 131 }, len 6 }, { dim 2, ids { local str "consensus", gi 14017877 }, starts { 65, 142 }, len 2 }, { dim 2, ids { local str "consensus", gi 14017877 }, starts { 67, 144 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 15602965 }, starts { 0, 0 }, len 6 }, { dim 2, ids { local str "consensus", gi 15602965 }, starts { 11, 11 }, len 3 }, { dim 2, ids { local str "consensus", gi 15602965 }, starts { 30, 27 }, len 6 }, { dim 2, ids { local str "consensus", gi 15602965 }, starts { 54, 52 }, len 6 }, { dim 2, ids { local str "consensus", gi 15602965 }, starts { 65, 60 }, len 2 }, { dim 2, ids { local str "consensus", gi 15602965 }, starts { 67, 62 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 15721860 }, starts { 0, 29 }, len 6 }, { dim 2, ids { local str "consensus", gi 15721860 }, starts { 11, 40 }, len 3 }, { dim 2, ids { local str "consensus", gi 15721860 }, starts { 30, 61 }, len 6 }, { dim 2, ids { local str "consensus", gi 15721860 }, starts { 54, 81 }, len 6 }, { dim 2, ids { local str "consensus", gi 15721860 }, starts { 65, 93 }, len 2 }, { dim 2, ids { local str "consensus", gi 15721860 }, starts { 67, 95 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 15901312 }, starts { 0, 1 }, len 6 }, { dim 2, ids { local str "consensus", gi 15901312 }, starts { 11, 12 }, len 3 }, { dim 2, ids { local str "consensus", gi 15901312 }, starts { 30, 26 }, len 6 }, { dim 2, ids { local str "consensus", gi 15901312 }, starts { 54, 94 }, len 6 }, { dim 2, ids { local str "consensus", gi 15901312 }, starts { 65, 102 }, len 2 }, { dim 2, ids { local str "consensus", gi 15901312 }, starts { 67, 104 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 16502979 }, starts { 0, 38 }, len 6 }, { dim 2, ids { local str "consensus", gi 16502979 }, starts { 11, 49 }, len 3 }, { dim 2, ids { local str "consensus", gi 16502979 }, starts { 30, 71 }, len 6 }, { dim 2, ids { local str "consensus", gi 16502979 }, starts { 54, 92 }, len 6 }, { dim 2, ids { local str "consensus", gi 16502979 }, starts { 65, 104 }, len 2 }, { dim 2, ids { local str "consensus", gi 16502979 }, starts { 67, 106 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 17507915 }, starts { 0, 150 }, len 6 }, { dim 2, ids { local str "consensus", gi 17507915 }, starts { 11, 161 }, len 3 }, { dim 2, ids { local str "consensus", gi 17507915 }, starts { 30, 177 }, len 6 }, { dim 2, ids { local str "consensus", gi 17507915 }, starts { 54, 193 }, len 6 }, { dim 2, ids { local str "consensus", gi 17507915 }, starts { 65, 212 }, len 2 }, { dim 2, ids { local str "consensus", gi 17507915 }, starts { 67, 214 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 17540154 }, starts { 0, 71 }, len 6 }, { dim 2, ids { local str "consensus", gi 17540154 }, starts { 11, 82 }, len 3 }, { dim 2, ids { local str "consensus", gi 17540154 }, starts { 30, 105 }, len 6 }, { dim 2, ids { local str "consensus", gi 17540154 }, starts { 54, 128 }, len 6 }, { dim 2, ids { local str "consensus", gi 17540154 }, starts { 65, 144 }, len 2 }, { dim 2, ids { local str "consensus", gi 17540154 }, starts { 67, 146 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 18271743 }, starts { 0, 26 }, len 6 }, { dim 2, ids { local str "consensus", gi 18271743 }, starts { 11, 37 }, len 3 }, { dim 2, ids { local str "consensus", gi 18271743 }, starts { 30, 57 }, len 6 }, { dim 2, ids { local str "consensus", gi 18271743 }, starts { 54, 78 }, len 6 }, { dim 2, ids { local str "consensus", gi 18271743 }, starts { 65, 90 }, len 2 }, { dim 2, ids { local str "consensus", gi 18271743 }, starts { 67, 92 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 18413285 }, starts { 0, 130 }, len 6 }, { dim 2, ids { local str "consensus", gi 18413285 }, starts { 11, 141 }, len 3 }, { dim 2, ids { local str "consensus", gi 18413285 }, starts { 30, 155 }, len 6 }, { dim 2, ids { local str "consensus", gi 18413285 }, starts { 54, 181 }, len 6 }, { dim 2, ids { local str "consensus", gi 18413285 }, starts { 65, 190 }, len 2 }, { dim 2, ids { local str "consensus", gi 18413285 }, starts { 67, 192 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 19923987 }, starts { 0, 35 }, len 6 }, { dim 2, ids { local str "consensus", gi 19923987 }, starts { 11, 46 }, len 3 }, { dim 2, ids { local str "consensus", gi 19923987 }, starts { 30, 74 }, len 6 }, { dim 2, ids { local str "consensus", gi 19923987 }, starts { 54, 120 }, len 6 }, { dim 2, ids { local str "consensus", gi 19923987 }, starts { 65, 133 }, len 2 }, { dim 2, ids { local str "consensus", gi 19923987 }, starts { 67, 135 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 20259149 }, starts { 0, 77 }, len 6 }, { dim 2, ids { local str "consensus", gi 20259149 }, starts { 11, 88 }, len 3 }, { dim 2, ids { local str "consensus", gi 20259149 }, starts { 30, 107 }, len 6 }, { dim 2, ids { local str "consensus", gi 20259149 }, starts { 54, 129 }, len 6 }, { dim 2, ids { local str "consensus", gi 20259149 }, starts { 65, 140 }, len 2 }, { dim 2, ids { local str "consensus", gi 20259149 }, starts { 67, 142 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 20454906 }, starts { 0, 375 }, len 6 }, { dim 2, ids { local str "consensus", gi 20454906 }, starts { 11, 387 }, len 3 }, { dim 2, ids { local str "consensus", gi 20454906 }, starts { 30, 409 }, len 6 }, { dim 2, ids { local str "consensus", gi 20454906 }, starts { 54, 448 }, len 6 }, { dim 2, ids { local str "consensus", gi 20454906 }, starts { 65, 465 }, len 2 }, { dim 2, ids { local str "consensus", gi 20454906 }, starts { 67, 467 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 20455499 }, starts { 0, 131 }, len 6 }, { dim 2, ids { local str "consensus", gi 20455499 }, starts { 11, 139 }, len 3 }, { dim 2, ids { local str "consensus", gi 20455499 }, starts { 30, 170 }, len 6 }, { dim 2, ids { local str "consensus", gi 20455499 }, starts { 54, 183 }, len 6 }, { dim 2, ids { local str "consensus", gi 20455499 }, starts { 65, 190 }, len 2 }, { dim 2, ids { local str "consensus", gi 20455499 }, starts { 67, 192 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 22652727 }, starts { 0, 109 }, len 6 }, { dim 2, ids { local str "consensus", gi 22652727 }, starts { 11, 117 }, len 3 }, { dim 2, ids { local str "consensus", gi 22652727 }, starts { 30, 140 }, len 6 }, { dim 2, ids { local str "consensus", gi 22652727 }, starts { 54, 153 }, len 6 }, { dim 2, ids { local str "consensus", gi 22652727 }, starts { 65, 160 }, len 2 }, { dim 2, ids { local str "consensus", gi 22652727 }, starts { 67, 162 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 22654216 }, starts { 0, 33 }, len 6 }, { dim 2, ids { local str "consensus", gi 22654216 }, starts { 11, 45 }, len 3 }, { dim 2, ids { local str "consensus", gi 22654216 }, starts { 30, 66 }, len 6 }, { dim 2, ids { local str "consensus", gi 22654216 }, starts { 54, 120 }, len 6 }, { dim 2, ids { local str "consensus", gi 22654216 }, starts { 65, 133 }, len 2 }, { dim 2, ids { local str "consensus", gi 22654216 }, starts { 67, 135 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 24211445 }, starts { 0, 376 }, len 6 }, { dim 2, ids { local str "consensus", gi 24211445 }, starts { 11, 387 }, len 3 }, { dim 2, ids { local str "consensus", gi 24211445 }, starts { 30, 408 }, len 6 }, { dim 2, ids { local str "consensus", gi 24211445 }, starts { 54, 431 }, len 6 }, { dim 2, ids { local str "consensus", gi 24211445 }, starts { 65, 444 }, len 2 }, { dim 2, ids { local str "consensus", gi 24211445 }, starts { 67, 446 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 24308127 }, starts { 0, 149 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 11, 160 }, len 3 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 30, 180 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 54, 201 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 65, 213 }, len 2 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 67, 215 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 24308127 }, starts { 0, 471 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 11, 482 }, len 3 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 30, 502 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 54, 523 }, len 6 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 65, 534 }, len 2 }, { dim 2, ids { local str "consensus", gi 24308127 }, starts { 67, 536 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 24414114 }, starts { 0, 173 }, len 6 }, { dim 2, ids { local str "consensus", gi 24414114 }, starts { 11, 185 }, len 3 }, { dim 2, ids { local str "consensus", gi 24414114 }, starts { 30, 207 }, len 6 }, { dim 2, ids { local str "consensus", gi 24414114 }, starts { 54, 230 }, len 6 }, { dim 2, ids { local str "consensus", gi 24414114 }, starts { 65, 247 }, len 2 }, { dim 2, ids { local str "consensus", gi 24414114 }, starts { 67, 249 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 26394420 }, starts { 0, 18 }, len 6 }, { dim 2, ids { local str "consensus", gi 26394420 }, starts { 11, 29 }, len 3 }, { dim 2, ids { local str "consensus", gi 26394420 }, starts { 30, 47 }, len 6 }, { dim 2, ids { local str "consensus", gi 26394420 }, starts { 54, 72 }, len 6 }, { dim 2, ids { local str "consensus", gi 26394420 }, starts { 65, 80 }, len 2 }, { dim 2, ids { local str "consensus", gi 26394420 }, starts { 67, 82 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 29839560 }, starts { 0, 208 }, len 6 }, { dim 2, ids { local str "consensus", gi 29839560 }, starts { 11, 219 }, len 3 }, { dim 2, ids { local str "consensus", gi 29839560 }, starts { 30, 241 }, len 6 }, { dim 2, ids { local str "consensus", gi 29839560 }, starts { 54, 262 }, len 6 }, { dim 2, ids { local str "consensus", gi 29839560 }, starts { 65, 274 }, len 2 }, { dim 2, ids { local str "consensus", gi 29839560 }, starts { 67, 276 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 31077035 }, starts { 0, 49 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 11, 60 }, len 3 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 30, 86 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 54, 107 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 65, 120 }, len 2 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 67, 122 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 31077035 }, starts { 0, 162 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 11, 174 }, len 3 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 30, 194 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 54, 205 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 65, 216 }, len 2 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 67, 218 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 31077035 }, starts { 0, 263 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 11, 276 }, len 3 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 30, 295 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 54, 318 }, len 6 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 65, 329 }, len 2 }, { dim 2, ids { local str "consensus", gi 31077035 }, starts { 67, 331 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 31432722 }, starts { 0, 234 }, len 6 }, { dim 2, ids { local str "consensus", gi 31432722 }, starts { 11, 245 }, len 3 }, { dim 2, ids { local str "consensus", gi 31432722 }, starts { 30, 259 }, len 6 }, { dim 2, ids { local str "consensus", gi 31432722 }, starts { 54, 285 }, len 6 }, { dim 2, ids { local str "consensus", gi 31432722 }, starts { 65, 292 }, len 2 }, { dim 2, ids { local str "consensus", gi 31432722 }, starts { 67, 294 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 31542723 }, starts { 0, 117 }, len 6 }, { dim 2, ids { local str "consensus", gi 31542723 }, starts { 11, 128 }, len 3 }, { dim 2, ids { local str "consensus", gi 31542723 }, starts { 30, 151 }, len 6 }, { dim 2, ids { local str "consensus", gi 31542723 }, starts { 54, 187 }, len 6 }, { dim 2, ids { local str "consensus", gi 31542723 }, starts { 65, 204 }, len 2 }, { dim 2, ids { local str "consensus", gi 31542723 }, starts { 67, 206 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 33149331 }, starts { 0, 328 }, len 6 }, { dim 2, ids { local str "consensus", gi 33149331 }, starts { 11, 344 }, len 3 }, { dim 2, ids { local str "consensus", gi 33149331 }, starts { 30, 369 }, len 6 }, { dim 2, ids { local str "consensus", gi 33149331 }, starts { 54, 392 }, len 6 }, { dim 2, ids { local str "consensus", gi 33149331 }, starts { 65, 405 }, len 2 }, { dim 2, ids { local str "consensus", gi 33149331 }, starts { 67, 407 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 34576294 }, starts { 0, 404 }, len 6 }, { dim 2, ids { local str "consensus", gi 34576294 }, starts { 11, 415 }, len 3 }, { dim 2, ids { local str "consensus", gi 34576294 }, starts { 30, 435 }, len 6 }, { dim 2, ids { local str "consensus", gi 34576294 }, starts { 54, 456 }, len 6 }, { dim 2, ids { local str "consensus", gi 34576294 }, starts { 65, 468 }, len 2 }, { dim 2, ids { local str "consensus", gi 34576294 }, starts { 67, 470 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 35214022 }, starts { 0, 4 }, len 6 }, { dim 2, ids { local str "consensus", gi 35214022 }, starts { 11, 16 }, len 3 }, { dim 2, ids { local str "consensus", gi 35214022 }, starts { 30, 30 }, len 6 }, { dim 2, ids { local str "consensus", gi 35214022 }, starts { 54, 56 }, len 6 }, { dim 2, ids { local str "consensus", gi 35214022 }, starts { 65, 63 }, len 2 }, { dim 2, ids { local str "consensus", gi 35214022 }, starts { 67, 65 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 38257679 }, starts { 0, 25 }, len 6 }, { dim 2, ids { local str "consensus", gi 38257679 }, starts { 11, 36 }, len 3 }, { dim 2, ids { local str "consensus", gi 38257679 }, starts { 30, 50 }, len 6 }, { dim 2, ids { local str "consensus", gi 38257679 }, starts { 54, 77 }, len 6 }, { dim 2, ids { local str "consensus", gi 38257679 }, starts { 65, 84 }, len 2 }, { dim 2, ids { local str "consensus", gi 38257679 }, starts { 67, 86 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 38505222 }, starts { 0, 44 }, len 6 }, { dim 2, ids { local str "consensus", gi 38505222 }, starts { 11, 55 }, len 3 }, { dim 2, ids { local str "consensus", gi 38505222 }, starts { 30, 78 }, len 6 }, { dim 2, ids { local str "consensus", gi 38505222 }, starts { 54, 99 }, len 6 }, { dim 2, ids { local str "consensus", gi 38505222 }, starts { 65, 110 }, len 2 }, { dim 2, ids { local str "consensus", gi 38505222 }, starts { 67, 112 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 39934075 }, starts { 0, 3 }, len 6 }, { dim 2, ids { local str "consensus", gi 39934075 }, starts { 11, 14 }, len 3 }, { dim 2, ids { local str "consensus", gi 39934075 }, starts { 30, 28 }, len 6 }, { dim 2, ids { local str "consensus", gi 39934075 }, starts { 54, 92 }, len 6 }, { dim 2, ids { local str "consensus", gi 39934075 }, starts { 65, 99 }, len 2 }, { dim 2, ids { local str "consensus", gi 39934075 }, starts { 67, 101 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 41056563 }, starts { 0, 59 }, len 6 }, { dim 2, ids { local str "consensus", gi 41056563 }, starts { 11, 71 }, len 3 }, { dim 2, ids { local str "consensus", gi 41056563 }, starts { 30, 94 }, len 6 }, { dim 2, ids { local str "consensus", gi 41056563 }, starts { 54, 128 }, len 6 }, { dim 2, ids { local str "consensus", gi 41056563 }, starts { 65, 144 }, len 2 }, { dim 2, ids { local str "consensus", gi 41056563 }, starts { 67, 146 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 42571571 }, starts { 0, 99 }, len 6 }, { dim 2, ids { local str "consensus", gi 42571571 }, starts { 11, 110 }, len 3 }, { dim 2, ids { local str "consensus", gi 42571571 }, starts { 30, 131 }, len 6 }, { dim 2, ids { local str "consensus", gi 42571571 }, starts { 54, 181 }, len 6 }, { dim 2, ids { local str "consensus", gi 42571571 }, starts { 65, 198 }, len 2 }, { dim 2, ids { local str "consensus", gi 42571571 }, starts { 67, 200 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 46141045 }, starts { 0, 4 }, len 6 }, { dim 2, ids { local str "consensus", gi 46141045 }, starts { 11, 15 }, len 3 }, { dim 2, ids { local str "consensus", gi 46141045 }, starts { 30, 33 }, len 6 }, { dim 2, ids { local str "consensus", gi 46141045 }, starts { 54, 173 }, len 6 }, { dim 2, ids { local str "consensus", gi 46141045 }, starts { 65, 182 }, len 2 }, { dim 2, ids { local str "consensus", gi 46141045 }, starts { 67, 184 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 47086881 }, starts { 0, 21 }, len 6 }, { dim 2, ids { local str "consensus", gi 47086881 }, starts { 11, 40 }, len 3 }, { dim 2, ids { local str "consensus", gi 47086881 }, starts { 30, 54 }, len 6 }, { dim 2, ids { local str "consensus", gi 47086881 }, starts { 54, 72 }, len 6 }, { dim 2, ids { local str "consensus", gi 47086881 }, starts { 65, 79 }, len 2 }, { dim 2, ids { local str "consensus", gi 47086881 }, starts { 67, 81 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 47117631 }, starts { 0, 47 }, len 6 }, { dim 2, ids { local str "consensus", gi 47117631 }, starts { 11, 58 }, len 3 }, { dim 2, ids { local str "consensus", gi 47117631 }, starts { 30, 79 }, len 6 }, { dim 2, ids { local str "consensus", gi 47117631 }, starts { 54, 100 }, len 6 }, { dim 2, ids { local str "consensus", gi 47117631 }, starts { 65, 111 }, len 2 }, { dim 2, ids { local str "consensus", gi 47117631 }, starts { 67, 113 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 50083312 }, starts { 0, 0 }, len 6 }, { dim 2, ids { local str "consensus", gi 50083312 }, starts { 11, 11 }, len 3 }, { dim 2, ids { local str "consensus", gi 50083312 }, starts { 30, 25 }, len 6 }, { dim 2, ids { local str "consensus", gi 50083312 }, starts { 54, 52 }, len 6 }, { dim 2, ids { local str "consensus", gi 50083312 }, starts { 65, 60 }, len 2 }, { dim 2, ids { local str "consensus", gi 50083312 }, starts { 67, 62 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 50401164 }, starts { 0, 115 }, len 6 }, { dim 2, ids { local str "consensus", gi 50401164 }, starts { 11, 126 }, len 3 }, { dim 2, ids { local str "consensus", gi 50401164 }, starts { 30, 145 }, len 6 }, { dim 2, ids { local str "consensus", gi 50401164 }, starts { 54, 163 }, len 6 }, { dim 2, ids { local str "consensus", gi 50401164 }, starts { 65, 175 }, len 2 }, { dim 2, ids { local str "consensus", gi 50401164 }, starts { 67, 177 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 51702156 }, starts { 0, 26 }, len 6 }, { dim 2, ids { local str "consensus", gi 51702156 }, starts { 11, 37 }, len 3 }, { dim 2, ids { local str "consensus", gi 51702156 }, starts { 30, 57 }, len 6 }, { dim 2, ids { local str "consensus", gi 51702156 }, starts { 54, 78 }, len 6 }, { dim 2, ids { local str "consensus", gi 51702156 }, starts { 65, 91 }, len 2 }, { dim 2, ids { local str "consensus", gi 51702156 }, starts { 67, 101 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 54633317 }, starts { 0, 128 }, len 6 }, { dim 2, ids { local str "consensus", gi 54633317 }, starts { 11, 139 }, len 3 }, { dim 2, ids { local str "consensus", gi 54633317 }, starts { 30, 159 }, len 6 }, { dim 2, ids { local str "consensus", gi 54633317 }, starts { 54, 181 }, len 6 }, { dim 2, ids { local str "consensus", gi 54633317 }, starts { 65, 193 }, len 2 }, { dim 2, ids { local str "consensus", gi 54633317 }, starts { 67, 195 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 55926090 }, starts { 0, 4 }, len 6 }, { dim 2, ids { local str "consensus", gi 55926090 }, starts { 11, 22 }, len 3 }, { dim 2, ids { local str "consensus", gi 55926090 }, starts { 30, 36 }, len 6 }, { dim 2, ids { local str "consensus", gi 55926090 }, starts { 54, 53 }, len 6 }, { dim 2, ids { local str "consensus", gi 55926090 }, starts { 65, 61 }, len 2 }, { dim 2, ids { local str "consensus", gi 55926090 }, starts { 67, 63 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 55960250 }, starts { 0, 162 }, len 6 }, { dim 2, ids { local str "consensus", gi 55960250 }, starts { 11, 173 }, len 3 }, { dim 2, ids { local str "consensus", gi 55960250 }, starts { 30, 194 }, len 6 }, { dim 2, ids { local str "consensus", gi 55960250 }, starts { 54, 215 }, len 6 }, { dim 2, ids { local str "consensus", gi 55960250 }, starts { 65, 225 }, len 2 }, { dim 2, ids { local str "consensus", gi 55960250 }, starts { 67, 227 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 56203088 }, starts { 0, 193 }, len 6 }, { dim 2, ids { local str "consensus", gi 56203088 }, starts { 11, 212 }, len 3 }, { dim 2, ids { local str "consensus", gi 56203088 }, starts { 30, 226 }, len 6 }, { dim 2, ids { local str "consensus", gi 56203088 }, starts { 54, 241 }, len 6 }, { dim 2, ids { local str "consensus", gi 56203088 }, starts { 65, 248 }, len 2 }, { dim 2, ids { local str "consensus", gi 56203088 }, starts { 67, 250 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 67847852 }, starts { 0, 13 }, len 6 }, { dim 2, ids { local str "consensus", gi 67847852 }, starts { 11, 24 }, len 3 }, { dim 2, ids { local str "consensus", gi 67847852 }, starts { 30, 38 }, len 6 }, { dim 2, ids { local str "consensus", gi 67847852 }, starts { 54, 62 }, len 6 }, { dim 2, ids { local str "consensus", gi 67847852 }, starts { 65, 70 }, len 2 }, { dim 2, ids { local str "consensus", gi 67847852 }, starts { 67, 72 }, len 2 } } }, { type partial, dim 2, segs dendiag { { dim 2, ids { local str "consensus", gi 47222013 }, starts { 0, 406 }, len 6 }, { dim 2, ids { local str "consensus", gi 47222013 }, starts { 11, 417 }, len 3 }, { dim 2, ids { local str "consensus", gi 47222013 }, starts { 30, 439 }, len 6 }, { dim 2, ids { local str "consensus", gi 47222013 }, starts { 54, 462 }, len 6 }, { dim 2, ids { local str "consensus", gi 47222013 }, starts { 65, 474 }, len 2 }, { dim 2, ids { local str "consensus", gi 47222013 }, starts { 67, 476 }, len 2 } } } } } }, features { id { mmdb-id 2963 }, descr { }, features { { id 29630100, features { { id 579301001, name "2TRXA0 1MEK 0 Structure alignment of slave 1MEK with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 5793 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 39, to 41 }, { molecule-id 1, from 62, to 67 }, { molecule-id 1, from 83, to 88 }, { molecule-id 1, from 97, to 98 }, { molecule-id 1, from 99, to 100 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 344696, tran-2 277928, tran-3 210996 }, rotate { scale-factor 100000, rot-11 18176, rot-12 -91940, rot-13 34880, rot-21 2160, rot-22 35835, rot-23 93333, rot-31 -98310, rot-32 -16210, rot-33 8499 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 976601011, name "2TRXA0 1A8L 1 Structure alignment of slave 1A8L with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9766 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 26, to 31 }, { molecule-id 1, from 38, to 40 }, { molecule-id 1, from 57, to 62 }, { molecule-id 1, from 80, to 85 }, { molecule-id 1, from 92, to 93 }, { molecule-id 1, from 94, to 95 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -931680, tran-2 -3142988, tran-3 -4192751 }, rotate { scale-factor 100000, rot-11 -21777, rot-12 -84331, rot-13 -49131, rot-21 62710, rot-22 -50663, rot-23 59165, rot-31 -74787, rot-32 -17926, rot-33 63918 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 976701021, name "2TRXA0 1A8Y 2 Structure alignment of slave 1A8Y with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9767 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 148, to 153 }, { molecule-id 1, from 160, to 162 }, { molecule-id 1, from 176, to 181 }, { molecule-id 1, from 193, to 198 }, { molecule-id 1, from 206, to 207 }, { molecule-id 1, from 208, to 209 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -4881860, tran-2 -10028040, tran-3 -10613484 }, rotate { scale-factor 100000, rot-11 -43478, rot-12 32144, rot-13 -84120, rot-21 41253, rot-22 90143, rot-23 13123, rot-31 80048, rot-32 -28997, rot-33 -52454 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 976701031, name "2TRXA0 1A8Y 3 Structure alignment of slave 1A8Y with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9767 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 251, to 256 }, { molecule-id 1, from 266, to 268 }, { molecule-id 1, from 284, to 289 }, { molecule-id 1, from 310, to 315 }, { molecule-id 1, from 323, to 324 }, { molecule-id 1, from 325, to 326 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1710160, tran-2 -9435428, tran-3 -9725096 }, rotate { scale-factor 100000, rot-11 -99993, rot-12 246, rot-13 -1122, rot-21 659, rot-22 -67710, rot-23 -73585, rot-31 -940, rot-32 -73588, rot-33 67704 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 976701011, name "2TRXA0 1A8Y 1 Structure alignment of slave 1A8Y with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9767 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 34, to 39 }, { molecule-id 1, from 55, to 57 }, { molecule-id 1, from 72, to 77 }, { molecule-id 1, from 93, to 98 }, { molecule-id 1, from 104, to 105 }, { molecule-id 1, from 106, to 107 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -3805236, tran-2 -6969604, tran-3 -9751576 }, rotate { scale-factor 100000, rot-11 -28734, rot-12 -14099, rot-13 94739, rot-21 84407, rot-22 -50480, rot-23 18087, rot-31 45274, rot-32 85164, rot-33 26406 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1745303031, name "2TRXA0 1B9YC3 Structure alignment of slave 1B9Y_C with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 17453 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 3, from 137, to 142 }, { molecule-id 3, from 148, to 150 }, { molecule-id 3, from 167, to 172 }, { molecule-id 3, from 187, to 192 }, { molecule-id 3, from 199, to 200 }, { molecule-id 3, from 201, to 202 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -19440999, tran-2 -9530620, tran-3 -6215364 }, rotate { scale-factor 100000, rot-11 -66955, rot-12 -27906, rot-13 -68834, rot-21 69571, rot-22 -56021, rot-23 -44960, rot-31 -26015, rot-32 -77992, rot-33 56923 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 873804071, name "2TRXA0 1BYED7 Structure alignment of slave 1BYE_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 8738 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 3, to 8 }, { molecule-id 4, from 14, to 16 }, { molecule-id 4, from 28, to 33 }, { molecule-id 4, from 55, to 60 }, { molecule-id 4, from 62, to 63 }, { molecule-id 4, from 64, to 65 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 1576608, tran-2 -2791519, tran-3 -5171836 }, rotate { scale-factor 100000, rot-11 -47163, rot-12 81539, rot-13 -33569, rot-21 87932, rot-22 46334, rot-23 -10997, rot-31 6587, rot-32 -34705, rot-33 -93552 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 80401011, name "2TRXA0 1DSBA1 Structure alignment of slave 1DSB_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 804 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 22, to 27 }, { molecule-id 1, from 33, to 35 }, { molecule-id 1, from 56, to 61 }, { molecule-id 1, from 151, to 156 }, { molecule-id 1, from 159, to 160 }, { molecule-id 1, from 161, to 162 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -889684, tran-2 -2500584, tran-3 -3247324 }, rotate { scale-factor 100000, rot-11 -48857, rot-12 18862, rot-13 85189, rot-21 6727, rot-22 98159, rot-23 -17875, rot-31 -86992, rot-32 -3002, rot-33 -49226 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1673101011, name "2TRXA0 1E6BA1 Structure alignment of slave 1E6B_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 16731 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 9, to 14 }, { molecule-id 1, from 20, to 22 }, { molecule-id 1, from 34, to 39 }, { molecule-id 1, from 61, to 66 }, { molecule-id 1, from 68, to 69 }, { molecule-id 1, from 70, to 71 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2293568, tran-2 -2814340, tran-3 -10066143 }, rotate { scale-factor 100000, rot-11 47774, rot-12 -43628, rot-13 76250, rot-21 71509, rot-22 69730, rot-23 -4906, rot-31 -51029, rot-32 56870, rot-33 64511 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1373201021, name "2TRXA0 1EEJA2 Structure alignment of slave 1EEJ_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 13732 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 90, to 95 }, { molecule-id 1, from 101, to 103 }, { molecule-id 1, from 118, to 123 }, { molecule-id 1, from 183, to 188 }, { molecule-id 1, from 191, to 192 }, { molecule-id 1, from 193, to 194 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -653944, tran-2 -1685260, tran-3 -1879860 }, rotate { scale-factor 100000, rot-11 -9880, rot-12 71496, rot-13 -69214, rot-21 97414, rot-22 -7251, rot-23 -21396, rot-31 -20316, rot-32 -69539, rot-33 -68931 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1416601011, name "2TRXA0 1EEMA1 Structure alignment of slave 1EEM_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 14166 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 49, to 54 }, { molecule-id 1, from 73, to 78 }, { molecule-id 1, from 81, to 82 }, { molecule-id 1, from 83, to 84 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2620236, tran-2 -1139535, tran-3 -3175595 }, rotate { scale-factor 100000, rot-11 -2025, rot-12 -68740, rot-13 72599, rot-21 -99943, rot-22 -566, rot-23 -3325, rot-31 2697, rot-32 -72625, rot-33 -68689 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1363904001, name "2TRXA0 1F2ED0 Structure alignment of slave 1F2E_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 13639 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 1, to 6 }, { molecule-id 4, from 11, to 13 }, { molecule-id 4, from 25, to 30 }, { molecule-id 4, from 53, to 58 }, { molecule-id 4, from 61, to 62 }, { molecule-id 4, from 63, to 64 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -5119060, tran-2 1194192, tran-3 -2490547 }, rotate { scale-factor 100000, rot-11 -17273, rot-12 -97015, rot-13 17015, rot-21 -10649, rot-22 -15334, rot-23 -98241, rot-31 97919, rot-32 -18782, rot-33 -7683 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1632301001, name "2TRXA0 1FO5A0 Structure alignment of slave 1FO5_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 16323 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 6, to 11 }, { molecule-id 1, from 17, to 19 }, { molecule-id 1, from 37, to 42 }, { molecule-id 1, from 58, to 63 }, { molecule-id 1, from 65, to 66 }, { molecule-id 1, from 67, to 68 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 72023, tran-2 -312628, tran-3 -23640 }, rotate { scale-factor 100000, rot-11 91495, rot-12 12943, rot-13 38224, rot-21 100, rot-22 94643, rot-23 -32288, rot-31 -40356, rot-32 29581, rot-33 86581 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 800601031, name "2TRXA0 1FOHA3 Structure alignment of slave 1FOH_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 8006 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 512, to 517 }, { molecule-id 1, from 524, to 526 }, { molecule-id 1, from 558, to 563 }, { molecule-id 1, from 613, to 618 }, { molecule-id 1, from 626, to 627 }, { molecule-id 1, from 628, to 629 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -7781028, tran-2 -7211328, tran-3 -5101780 }, rotate { scale-factor 100000, rot-11 77801, rot-12 -40611, rot-13 -47933, rot-21 -62671, rot-22 -44850, rot-23 -63723, rot-31 4380, rot-32 79618, rot-33 -60346 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1476301001, name "2TRXA0 1FOVA0 Structure alignment of slave 1FOV_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 14763 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 3, to 8 }, { molecule-id 1, from 14, to 16 }, { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 53, to 58 }, { molecule-id 1, from 60, to 61 }, { molecule-id 1, from 62, to 63 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -136787, tran-2 -17283, tran-3 123860 }, rotate { scale-factor 100000, rot-11 -8880, rot-12 97943, rot-13 -18118, rot-21 49608, rot-22 20123, rot-23 84463, rot-31 86371, rot-32 -1488, rot-33 -50375 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1566702031, name "2TRXA0 1G6YB3 Structure alignment of slave 1G6Y_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 15667 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 21, to 26 }, { molecule-id 2, from 32, to 34 }, { molecule-id 2, from 46, to 51 }, { molecule-id 2, from 73, to 78 }, { molecule-id 2, from 83, to 84 }, { molecule-id 2, from 85, to 86 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -622467, tran-2 -1963295, tran-3 -1592063 }, rotate { scale-factor 100000, rot-11 -25336, rot-12 70877, rot-13 -65836, rot-21 -72791, rot-22 30856, rot-23 61231, rot-31 63714, rot-32 63437, rot-33 43774 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1448801001, name "2TRXA0 1G7EA0 Structure alignment of slave 1G7E_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 14488 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 25, to 30 }, { molecule-id 1, from 34, to 36 }, { molecule-id 1, from 56, to 61 }, { molecule-id 1, from 84, to 89 }, { molecule-id 1, from 98, to 99 }, { molecule-id 1, from 100, to 101 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -522116, tran-2 -313595, tran-3 -277164 }, rotate { scale-factor 100000, rot-11 -2870, rot-12 -39332, rot-13 -91894, rot-21 27464, rot-22 88084, rot-23 -38559, rot-31 96111, rot-32 -26345, rot-33 8274 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1693701011, name "2TRXA0 1G7OA1 Structure alignment of slave 1G7O_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 16937 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 1, to 6 }, { molecule-id 1, from 12, to 14 }, { molecule-id 1, from 26, to 31 }, { molecule-id 1, from 49, to 54 }, { molecule-id 1, from 57, to 58 }, { molecule-id 1, from 59, to 60 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 314456, tran-2 -469151, tran-3 467144 }, rotate { scale-factor 100000, rot-11 -77343, rot-12 5213, rot-13 63173, rot-21 -60136, rot-22 25473, rot-23 -75727, rot-31 -20040, rot-32 -96560, rot-33 -16567 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 107601001, name "2TRXA0 1GP1A0 Structure alignment of slave 1GP1_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 1076 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 37, to 42 }, { molecule-id 1, from 48, to 50 }, { molecule-id 1, from 69, to 74 }, { molecule-id 1, from 160, to 165 }, { molecule-id 1, from 173, to 174 }, { molecule-id 1, from 175, to 176 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2910799, tran-2 -5601804, tran-3 -3993304 }, rotate { scale-factor 100000, rot-11 46240, rot-12 82092, rot-13 33507, rot-21 40235, rot-22 -53101, rot-23 74574, rot-31 79012, rot-32 -21001, rot-33 -57584 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 374902031, name "2TRXA0 1GSEB3 Structure alignment of slave 1GSE_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 3749 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 4, to 9 }, { molecule-id 2, from 15, to 17 }, { molecule-id 2, from 29, to 34 }, { molecule-id 2, from 55, to 60 }, { molecule-id 2, from 62, to 63 }, { molecule-id 2, from 64, to 65 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -6162019, tran-2 -643272, tran-3 -1399328 }, rotate { scale-factor 100000, rot-11 78861, rot-12 30096, rot-13 -53620, rot-21 -10653, rot-22 -79196, rot-23 -60120, rot-31 -60559, rot-32 53123, rot-33 -59248 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1678601001, name "2TRXA0 1H75A0 Structure alignment of slave 1H75_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 16786 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 3, to 8 }, { molecule-id 1, from 14, to 16 }, { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 52, to 57 }, { molecule-id 1, from 59, to 60 }, { molecule-id 1, from 61, to 62 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -259984, tran-2 -1980204, tran-3 -550524 }, rotate { scale-factor 100000, rot-11 -12865, rot-12 4679, rot-13 -99058, rot-21 74488, rot-22 66397, rot-23 -6537, rot-31 65466, rot-32 -74628, rot-33 -12027 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1571801011, name "2TRXA0 1HYUA1 Structure alignment of slave 1HYU_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 15718 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 121, to 126 }, { molecule-id 1, from 132, to 134 }, { molecule-id 1, from 151, to 156 }, { molecule-id 1, from 172, to 177 }, { molecule-id 1, from 179, to 180 }, { molecule-id 1, from 181, to 182 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -5488000, tran-2 -2781988, tran-3 329608 }, rotate { scale-factor 100000, rot-11 -78369, rot-12 38012, rot-13 -49125, rot-21 26412, rot-22 -51187, rot-23 -81744, rot-31 -56219, rot-32 -77038, rot-33 30075 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1571801012, name "2TRXA0 1HYUA1 Structure alignment of slave 1HYU_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 15718 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 23, to 28 }, { molecule-id 1, from 33, to 35 }, { molecule-id 1, from 52, to 57 }, { molecule-id 1, from 63, to 68 }, { molecule-id 1, from 75, to 76 }, { molecule-id 1, from 77, to 78 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -6548895, tran-2 -1651420, tran-3 -592375 }, rotate { scale-factor 100000, rot-11 -68518, rot-12 -67025, rot-13 -28508, rot-21 66703, rot-22 -73463, rot-23 12399, rot-31 -29254, rot-32 -10520, rot-33 95044 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -2038863225, name "2TRXA0 1IYID7 Structure alignment of slave 1IYI_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 22561 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 3, to 8 }, { molecule-id 4, from 14, to 16 }, { molecule-id 4, from 28, to 33 }, { molecule-id 4, from 51, to 56 }, { molecule-id 4, from 58, to 59 }, { molecule-id 4, from 60, to 61 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 459788, tran-2 24251, tran-3 -3001220 }, rotate { scale-factor 100000, rot-11 11486, rot-12 -19552, rot-13 -97394, rot-21 -21617, rot-22 -96186, rot-23 16760, rot-31 -96957, rot-32 19129, rot-33 -15274 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1808901001, name "2TRXA0 1J9BA0 Structure alignment of slave 1J9B_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 18089 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 4, to 9 }, { molecule-id 1, from 15, to 17 }, { molecule-id 1, from 29, to 34 }, { molecule-id 1, from 95, to 100 }, { molecule-id 1, from 102, to 103 }, { molecule-id 1, from 104, to 105 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2531452, tran-2 -5188788, tran-3 -5306344 }, rotate { scale-factor 100000, rot-11 -86150, rot-12 -9877, rot-13 49805, rot-21 -20514, rot-22 96498, rot-23 -16346, rot-31 -46446, rot-32 -24300, rot-33 -85159 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1735301001, name "2TRXA0 1JFUA0 Structure alignment of slave 1JFU_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 17353 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 64, to 69 }, { molecule-id 1, from 75, to 77 }, { molecule-id 1, from 96, to 101 }, { molecule-id 1, from 145, to 150 }, { molecule-id 1, from 158, to 159 }, { molecule-id 1, from 160, to 161 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -112280, tran-2 -2117012, tran-3 -937732 }, rotate { scale-factor 100000, rot-11 -81077, rot-12 2105, rot-13 58497, rot-21 53241, rot-22 44182, rot-23 72202, rot-31 -24325, rot-32 89685, rot-33 -36943 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1816101011, name "2TRXA0 1K0NA1 Structure alignment of slave 1K0N_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 18161 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 8, to 13 }, { molecule-id 1, from 27, to 29 }, { molecule-id 1, from 41, to 46 }, { molecule-id 1, from 65, to 70 }, { molecule-id 1, from 72, to 73 }, { molecule-id 1, from 74, to 75 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -485948, tran-2 -268940, tran-3 -2579648 }, rotate { scale-factor 100000, rot-11 19476, rot-12 -92079, rot-13 33795, rot-21 -85060, rot-22 1300, rot-23 52564, rot-31 -48839, rot-32 -38984, rot-33 -78069 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 2017401001, name "2TRXA0 1KNGA0 Structure alignment of slave 1KNG_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 20174 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 46, to 51 }, { molecule-id 1, from 57, to 59 }, { molecule-id 1, from 75, to 80 }, { molecule-id 1, from 119, to 124 }, { molecule-id 1, from 132, to 133 }, { molecule-id 1, from 134, to 135 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1191856, tran-2 -348047, tran-3 -1492387 }, rotate { scale-factor 100000, rot-11 -33681, rot-12 -61689, rot-13 -71133, rot-21 -20839, rot-22 78558, rot-23 -58260, rot-31 91822, rot-32 -4798, rot-33 -39315 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 478301001, name "2TRXA0 1KTE 0 Structure alignment of slave 1KTE with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 4783 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 14, to 19 }, { molecule-id 1, from 25, to 27 }, { molecule-id 1, from 42, to 47 }, { molecule-id 1, from 70, to 75 }, { molecule-id 1, from 77, to 78 }, { molecule-id 1, from 79, to 80 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2078156, tran-2 -3007027, tran-3 -922947 }, rotate { scale-factor 100000, rot-11 -98718, rot-12 -15606, rot-13 3330, rot-21 -15552, rot-22 98766, rot-23 1833, rot-31 -3575, rot-32 1292, rot-33 -99927 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1802366295, name "2TRXA0 1LU4A0 Structure alignment of slave 1LU4_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 24926 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 39, to 41 }, { molecule-id 1, from 58, to 63 }, { molecule-id 1, from 101, to 106 }, { molecule-id 1, from 113, to 114 }, { molecule-id 1, from 115, to 116 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1374084, tran-2 -668140, tran-3 -2815140 }, rotate { scale-factor 100000, rot-11 280, rot-12 58317, rot-13 81234, rot-21 99984, rot-22 -1591, rot-23 797, rot-31 1757, rot-32 81218, rot-33 -58312 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 2068601001, name "2TRXA0 1M2AA0 Structure alignment of slave 1M2A_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 20686 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 6, to 11 }, { molecule-id 1, from 22, to 24 }, { molecule-id 1, from 50, to 55 }, { molecule-id 1, from 63, to 68 }, { molecule-id 1, from 72, to 73 }, { molecule-id 1, from 74, to 75 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 235611, tran-2 -1267084, tran-3 -3758352 }, rotate { scale-factor 100000, rot-11 -69536, rot-12 15860, rot-13 70093, rot-21 -70648, rot-22 2785, rot-23 -70717, rot-31 -13168, rot-32 -98694, rot-33 9268 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -2107166285, name "2TRXA0 1NHYA1 Structure alignment of slave 1NHY_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 21878 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 4, to 9 }, { molecule-id 1, from 14, to 16 }, { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 50, to 55 }, { molecule-id 1, from 58, to 59 }, { molecule-id 1, from 60, to 61 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 1383908, tran-2 -956036, tran-3 -2474236 }, rotate { scale-factor 100000, rot-11 -3890, rot-12 -63430, rot-13 77210, rot-21 -99853, rot-22 -448, rot-23 -5399, rot-31 3771, rot-32 -77306, rot-33 -63320 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -2054165255, name "2TRXA0 1NM3B4 Structure alignment of slave 1NM3_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 22408 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 172, to 177 }, { molecule-id 2, from 183, to 185 }, { molecule-id 2, from 197, to 202 }, { molecule-id 2, from 221, to 226 }, { molecule-id 2, from 228, to 229 }, { molecule-id 2, from 230, to 231 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -733743, tran-2 -4332852, tran-3 671476 }, rotate { scale-factor 100000, rot-11 -90945, rot-12 -34137, rot-13 -23739, rot-21 34092, rot-22 -93904, rot-23 4429, rot-31 -23804, rot-32 -4065, rot-33 97040 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -2017866295, name "2TRXA0 1O73A0 Structure alignment of slave 1O73_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 22771 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 32, to 37 }, { molecule-id 1, from 43, to 45 }, { molecule-id 1, from 65, to 70 }, { molecule-id 1, from 110, to 115 }, { molecule-id 1, from 124, to 125 }, { molecule-id 1, from 126, to 127 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -899700, tran-2 368456, tran-3 1044296 }, rotate { scale-factor 100000, rot-11 47416, rot-12 55904, rot-13 68017, rot-21 -10875, rot-22 -72943, rot-23 67535, rot-31 87369, rot-32 -39420, rot-33 -28507 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1655665295, name "2TRXA0 1OC3B0 Structure alignment of slave 1OC3_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 26393 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 46, to 51 }, { molecule-id 2, from 58, to 60 }, { molecule-id 2, from 81, to 86 }, { molecule-id 2, from 138, to 143 }, { molecule-id 2, from 150, to 151 }, { molecule-id 2, from 152, to 153 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1594959, tran-2 3275632, tran-3 -7568704 }, rotate { scale-factor 100000, rot-11 28388, rot-12 95599, rot-13 7401, rot-21 -95501, rot-22 28880, rot-23 -6742, rot-31 -8583, rot-32 -5154, rot-33 99497 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1765166295, name "2TRXA0 1ON4A0 Structure alignment of slave 1ON4_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 25298 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 37, to 42 }, { molecule-id 1, from 49, to 51 }, { molecule-id 1, from 72, to 77 }, { molecule-id 1, from 137, to 142 }, { molecule-id 1, from 150, to 151 }, { molecule-id 1, from 152, to 153 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 208316, tran-2 -219008, tran-3 -203216 }, rotate { scale-factor 100000, rot-11 -91700, rot-12 -11242, rot-13 38269, rot-21 -33839, rot-22 -28865, rot-23 -89563, rot-31 21115, rot-32 -95081, rot-33 22665 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1937863225, name "2TRXA0 1OYJD7 Structure alignment of slave 1OYJ_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 23571 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 7, to 12 }, { molecule-id 4, from 18, to 20 }, { molecule-id 4, from 32, to 37 }, { molecule-id 4, from 57, to 62 }, { molecule-id 4, from 64, to 65 }, { molecule-id 4, from 66, to 67 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2576080, tran-2 -3896612, tran-3 -10320580 }, rotate { scale-factor 100000, rot-11 42932, rot-12 79823, rot-13 -42249, rot-21 -35952, rot-22 -27808, rot-23 -89073, rot-31 -82850, rot-32 53430, rot-33 16759 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 797801011, name "2TRXA0 1PRXA1 Structure alignment of slave 1PRX_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 7978 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 35, to 40 }, { molecule-id 1, from 47, to 49 }, { molecule-id 1, from 68, to 73 }, { molecule-id 1, from 132, to 137 }, { molecule-id 1, from 145, to 146 }, { molecule-id 1, from 147, to 148 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -3008228, tran-2 -696916, tran-3 -601564 }, rotate { scale-factor 100000, rot-11 -21473, rot-12 -20475, rot-13 95496, rot-21 7251, rot-22 -97842, rot-23 -19347, rot-31 97397, rot-32 2770, rot-33 22494 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1928565285, name "2TRXA0 1PSQB1 Structure alignment of slave 1PSQ_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 23664 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 46, to 51 }, { molecule-id 2, from 58, to 60 }, { molecule-id 2, from 77, to 82 }, { molecule-id 2, from 127, to 132 }, { molecule-id 2, from 140, to 141 }, { molecule-id 2, from 142, to 143 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2245764, tran-2 186984, tran-3 1162972 }, rotate { scale-factor 100000, rot-11 12770, rot-12 -95370, rot-13 -27229, rot-21 -11175, rot-22 25896, rot-23 -95940, rot-31 98549, rot-32 15295, rot-33 -7350 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1183101001, name "2TRXA0 1QGVA0 Structure alignment of slave 1QGV_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 11831 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 27, to 32 }, { molecule-id 1, from 38, to 40 }, { molecule-id 1, from 58, to 63 }, { molecule-id 1, from 79, to 84 }, { molecule-id 1, from 92, to 93 }, { molecule-id 1, from 102, to 103 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 1286132, tran-2 -2060772, tran-3 -387492 }, rotate { scale-factor 100000, rot-11 79620, rot-12 38242, rot-13 46883, rot-21 18057, rot-22 58938, rot-23 -78741, rot-31 -57744, rot-32 71160, rot-33 40021 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1377401011, name "2TRXA0 1QMVA1 Structure alignment of slave 1QMV_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 13774 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 38, to 43 }, { molecule-id 1, from 50, to 52 }, { molecule-id 1, from 71, to 76 }, { molecule-id 1, from 126, to 131 }, { molecule-id 1, from 139, to 140 }, { molecule-id 1, from 141, to 142 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2591004, tran-2 793464, tran-3 -8778740 }, rotate { scale-factor 100000, rot-11 13140, rot-12 -84193, rot-13 52333, rot-21 -61261, rot-22 34607, rot-23 71058, rot-31 -77938, rot-32 -41398, rot-33 -47030 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1678666295, name "2TRXA0 1R4WA0 Structure alignment of slave 1R4W_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 26163 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 8, to 13 }, { molecule-id 1, from 19, to 21 }, { molecule-id 1, from 37, to 42 }, { molecule-id 1, from 184, to 189 }, { molecule-id 1, from 195, to 196 }, { molecule-id 1, from 197, to 198 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 3746252, tran-2 1696496, tran-3 521072 }, rotate { scale-factor 100000, rot-11 -28135, rot-12 -88141, rot-13 37940, rot-21 33966, rot-22 -46125, rot-23 -81967, rot-31 89747, rot-32 -10174, rot-33 42916 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1307666295, name "2TRXA0 1RW1A0 Structure alignment of slave 1RW1_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 29873 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 2, to 7 }, { molecule-id 1, from 13, to 15 }, { molecule-id 1, from 27, to 32 }, { molecule-id 1, from 92, to 97 }, { molecule-id 1, from 99, to 100 }, { molecule-id 1, from 101, to 102 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1506460, tran-2 -1224256, tran-3 640580 }, rotate { scale-factor 100000, rot-11 -95205, rot-12 10651, rot-13 -28679, rot-21 6914, rot-22 98809, rot-23 13743, rot-31 29801, rot-32 11101, rot-33 -94808 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1438466295, name "2TRXA0 1SENA0 Structure alignment of slave 1SEN_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 28565 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 50, to 55 }, { molecule-id 1, from 61, to 63 }, { molecule-id 1, from 83, to 88 }, { molecule-id 1, from 105, to 110 }, { molecule-id 1, from 120, to 121 }, { molecule-id 1, from 131, to 132 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1623776, tran-2 -228867, tran-3 -1131904 }, rotate { scale-factor 100000, rot-11 8154, rot-12 -99613, rot-13 -3271, rot-21 -67701, rot-22 -7944, rot-23 73167, rot-31 -73144, rot-32 -3751, rot-33 -68087 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1464765295, name "2TRXA0 1T1VB0 Structure alignment of slave 1T1V_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 28302 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 4, to 9 }, { molecule-id 2, from 21, to 23 }, { molecule-id 2, from 35, to 40 }, { molecule-id 2, from 62, to 67 }, { molecule-id 2, from 69, to 70 }, { molecule-id 2, from 71, to 72 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1818976, tran-2 965260, tran-3 -1722480 }, rotate { scale-factor 100000, rot-11 -45818, rot-12 78089, rot-13 42458, rot-21 -84456, rot-22 -23356, rot-23 -48182, rot-31 -27708, rot-32 -57935, rot-33 76652 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1264666295, name "2TRXA0 1T4ZA0 Structure alignment of slave 1T4Z_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 30303 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 15, to 20 }, { molecule-id 1, from 25, to 27 }, { molecule-id 1, from 47, to 52 }, { molecule-id 1, from 68, to 73 }, { molecule-id 1, from 79, to 80 }, { molecule-id 1, from 81, to 82 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -692428, tran-2 -49983, tran-3 97943 }, rotate { scale-factor 100000, rot-11 -30084, rot-12 93366, rot-13 -19430, rot-21 -78072, rot-22 -35812, rot-23 -51205, rot-31 -54768, rot-32 -234, rot-33 83668 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1547666295, name "2TRXA0 1UC7A0 Structure alignment of slave 1UC7_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 27473 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 32, to 37 }, { molecule-id 1, from 43, to 45 }, { molecule-id 1, from 65, to 70 }, { molecule-id 1, from 90, to 95 }, { molecule-id 1, from 105, to 106 }, { molecule-id 1, from 107, to 108 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1170907, tran-2 -390300, tran-3 -5427544 }, rotate { scale-factor 100000, rot-11 73268, rot-12 -32514, rot-13 -59787, rot-21 58154, rot-22 75544, rot-23 30184, rot-31 35351, rot-32 -56884, rot-33 74258 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1777263225, name "2TRXA0 1V2AD7 Structure alignment of slave 1V2A_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 25177 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 1, to 6 }, { molecule-id 4, from 12, to 14 }, { molecule-id 4, from 26, to 31 }, { molecule-id 4, from 52, to 57 }, { molecule-id 4, from 59, to 60 }, { molecule-id 4, from 61, to 62 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -519951, tran-2 612123, tran-3 -1520815 }, rotate { scale-factor 100000, rot-11 41915, rot-12 65260, rot-13 63119, rot-21 -14515, rot-22 73444, rot-23 -66296, rot-31 -89623, rot-32 18626, rot-33 40257 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1235066295, name "2TRXA0 1WIKA0 Structure alignment of slave 1WIK_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 30599 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 17, to 22 }, { molecule-id 1, from 33, to 35 }, { molecule-id 1, from 47, to 52 }, { molecule-id 1, from 72, to 77 }, { molecule-id 1, from 79, to 80 }, { molecule-id 1, from 81, to 82 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 16680, tran-2 -108931, tran-3 51255 }, rotate { scale-factor 100000, rot-11 -25909, rot-12 5337, rot-13 96437, rot-21 -93701, rot-22 22826, rot-23 -26437, rot-31 -23424, rot-32 -97213, rot-33 -913 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1317966295, name "2TRXA0 1WOUA0 Structure alignment of slave 1WOU_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 29770 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 28, to 33 }, { molecule-id 1, from 46, to 48 }, { molecule-id 1, from 66, to 71 }, { molecule-id 1, from 94, to 99 }, { molecule-id 1, from 103, to 104 }, { molecule-id 1, from 105, to 106 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -901000, tran-2 -2525824, tran-3 -1163855 }, rotate { scale-factor 100000, rot-11 -96498, rot-12 -22479, rot-13 -13516, rot-21 -25986, rot-22 88934, rot-23 37620, rot-31 3563, rot-32 39815, rot-33 -91662 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1095565295, name "2TRXA0 1XVWB0 Structure alignment of slave 1XVW_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 31994 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 40, to 45 }, { molecule-id 2, from 52, to 54 }, { molecule-id 2, from 73, to 78 }, { molecule-id 2, from 123, to 128 }, { molecule-id 2, from 136, to 137 }, { molecule-id 2, from 138, to 139 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -3226328, tran-2 1531888, tran-3 -4289724 }, rotate { scale-factor 100000, rot-11 -15606, rot-12 98277, rot-13 -9896, rot-21 42627, rot-22 15739, rot-23 89079, rot-31 89103, rot-32 9683, rot-33 -44349 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1218965265, name "2TRXA0 1XW5B3 Structure alignment of slave 1XW5_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 30760 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 2, to 7 }, { molecule-id 2, from 13, to 15 }, { molecule-id 2, from 27, to 32 }, { molecule-id 2, from 60, to 65 }, { molecule-id 2, from 67, to 68 }, { molecule-id 2, from 69, to 70 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2697648, tran-2 -157799, tran-3 -1180124 }, rotate { scale-factor 100000, rot-11 -2630, rot-12 56892, rot-13 82196, rot-21 23026, rot-22 -79669, rot-23 55880, rot-31 97277, rot-32 20397, rot-33 -11004 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -1078566285, name "2TRXA0 1YY7A1 Structure alignment of slave 1YY7_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 32164 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 11, to 16 }, { molecule-id 1, from 22, to 24 }, { molecule-id 1, from 36, to 41 }, { molecule-id 1, from 60, to 65 }, { molecule-id 1, from 67, to 68 }, { molecule-id 1, from 69, to 70 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -7195995, tran-2 -2740888, tran-3 -322648 }, rotate { scale-factor 100000, rot-11 84437, rot-12 -23307, rot-13 -48239, rot-21 -53347, rot-22 -44863, rot-23 -71702, rot-31 -4929, rot-32 86278, rot-33 -50315 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id -956963225, name "2TRXA0 1Z9HD7 Structure alignment of slave 1Z9H_D with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 33380 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 4, from 15, to 20 }, { molecule-id 4, from 26, to 28 }, { molecule-id 4, from 40, to 45 }, { molecule-id 4, from 62, to 67 }, { molecule-id 4, from 73, to 74 }, { molecule-id 4, from 75, to 76 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -2705124, tran-2 -5728344, tran-3 -2307892 }, rotate { scale-factor 100000, rot-11 43577, rot-12 -20884, rot-13 87549, rot-21 -81057, rot-22 33175, rot-23 48260, rot-31 -39123, rot-32 -91995, rot-33 -2471 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 969301001, name "2TRXA0 2BJXA0 Structure alignment of slave 2BJX_A with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9693 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 1, from 22, to 27 }, { molecule-id 1, from 34, to 36 }, { molecule-id 1, from 49, to 54 }, { molecule-id 1, from 66, to 71 }, { molecule-id 1, from 79, to 80 }, { molecule-id 1, from 81, to 82 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -544924, tran-2 192240, tran-3 -147972 }, rotate { scale-factor 100000, rot-11 -53300, rot-12 69731, rot-13 -47922, rot-21 -15907, rot-22 47369, rot-23 86620, rot-31 83102, rot-32 53792, rot-33 -14155 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 986302021, name "2TRXA0 3LJRB2 Structure alignment of slave 3LJR_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 9863 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 3, to 8 }, { molecule-id 2, from 14, to 16 }, { molecule-id 2, from 28, to 33 }, { molecule-id 2, from 55, to 60 }, { molecule-id 2, from 62, to 63 }, { molecule-id 2, from 64, to 65 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -1784996, tran-2 -7857448, tran-3 -2907596 }, rotate { scale-factor 100000, rot-11 -56592, rot-12 -81795, rot-13 10334, rot-21 46089, rot-22 -20994, rot-23 86226, rot-31 -68359, rot-32 53560, rot-33 49580 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } }, { id 1104002031, name "2TRXA0 3PGTB3 Structure alignment of slave 3PGT_B with master 2TRX_A, as computed by Cn3D", type alignment, location alignment { dimension 2, biostruc-ids { mmdb-id 2963, mmdb-id 11040 }, alignment { residues interval { { molecule-id 1, from 24, to 29 }, { molecule-id 1, from 35, to 37 }, { molecule-id 1, from 55, to 60 }, { molecule-id 1, from 76, to 81 }, { molecule-id 1, from 88, to 89 }, { molecule-id 1, from 90, to 91 } }, residues interval { { molecule-id 2, from 4, to 9 }, { molecule-id 2, from 15, to 17 }, { molecule-id 2, from 29, to 34 }, { molecule-id 2, from 54, to 59 }, { molecule-id 2, from 61, to 62 }, { molecule-id 2, from 63, to 64 } } }, transform { { id 1, moves { translate { scale-factor 100000, tran-1 -917540, tran-2 -906283, tran-3 -3199144 }, rotate { scale-factor 100000, rot-11 -19813, rot-12 42916, rot-13 -88122, rot-21 -95428, rot-22 -28973, rot-23 7345, rot-31 -22379, rot-32 85549, rot-33 46694 }, translate { scale-factor 100000, tran-1 3404152, tran-2 3312291, tran-3 -357268 } } } } } } } } } }, sequences set { seq-set { seq { id { pdb { mol "2TRX", chain 65 }, gi 230777 }, descr { title "Chain A, Thioredoxin", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 108, seq-data ncbistdaa '11040A0909080B1204041106041204130B0A01040701090B 1304061401051403070E030A0C09010E090B040509010405160F070A0B1213010A0B0D09040F0D 0E0712010E0A1607091007090E120B0B0B060A0D0705130101120A1307010B110A070F0B0A0506 0B04010D0B01'H }, annot { { data ids { general { db "mmdb", tag id 2963 } } } } }, seq { id { pdb { mol "1MEK" }, gi 2098329 }, descr { title "Human Protein Disulfide Isomerase, Nmr, 40 Structures", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 120, seq-data ncbistdaa '04010E0505050408130B130B100A110D060105010B010108 0A160B0B13050616010E14030708030A010B010E0516010A0101070A0B0A010507110509100B01 0A13040112050511040B010F0F1607131007160E12090A0606100D07041201110E0A0516120107 100501040409130D140B0A0A1012070E0101'H }, annot { { data ids { general { db "mmdb", tag id 5793 } } } } }, seq { id { swissprot { name "PDIA5_HUMAN", accession "Q14554" }, gi 2501208 }, descr { title "Protein disulfide-isomerase A5 precursor (Protein disulfide isomerase-related protein)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 519, seq-data ncbistdaa '0C011001070E01140B0B0B01091413130B0E11140B111101 0A1311110B0905100911040E0A040B0A0A0B0B1012100D0D130B130B16110A1105130101050D08 0B100B0B111213010F01130A070F07120903141304030704010511100A0B030A0A0C0A13040B11 0E0A040A0A13050B0608160F04070106081205160D10011312060A11091301060B0A040E0A070E 0E0B140505040E07010A041313080B0411050A040610100B0B0A0A05050A0E0B0B090C0616010E 1403110C030A100C0C0E08060F0A0101120F0B10070801130B01070C0D131611110506050D090A 05051611131007060E1209031606050A0710060B060F16040D16071112010504091305140B0A0D 0E0F0E0E0F0E0F130E05120E140104050707111316080B1204050406040F06130A05081111130B 130C0608010E14030708030A0A0C0A0E0506050A010105010B0807050104111107130B01011304 0112130D0A010B0105100608091105060E120B0A16060A0D07050A1601130E130B10120A0A0A06 0B05140C0F0D0E05010E0E0E0E050E121405050F0F1211130B080B1307040D061005120B0A0A0A 0A08120B130C0616010E14030E08030A0A13090E0806120112010401060A0404100A0901030101 130403130A040A0D0F040B030F0F0501130A07160E12060816160816070A0601050A1604110410 12050B0706120D160910010B100507040805100B070A0A0A05050B'H } }, seq { id { gi 4699595, pdb { mol "1A8L" } }, descr { source { org { taxname "Pyrococcus furiosus", common "Pyrococcus furiosus", db { { db "taxon", tag id 2261 } } } }, title "Protein Disulfide Oxidoreductase From Archaeon Pyrococcus Furiosus" }, inst { repr raw, mol aa, length 226, seq-data ncbistdaa '0C070B09110401040A0A13090A05050606110A0C130D0E13 0A0B09130613100A0408030F1603040F0B0A0F0B130F050B11050B12040A0B1116050913040604 120E05070A050B010A101610090410010E01121209120F04070A04060713101606070B0E010708 05060101060B05040913041311100505120D0B0C0405120A0F0109100D09040F041310090B1306 13120E12030E16030E0B0113100C01080A060109050D120A01070A070A090B07040C1305010905 160E051401040F160D130C01130E0A0913090F130D07050410130506050701160E050A0C060B05 0A0B0B11010B11'H }, annot { { data ids { general { db "mmdb", tag id 9766 } } } } }, seq { id { pdb { mol "1A8Y", rel std { year 1998, month 3, day 31 } }, gi 4699596 }, descr { pdb { deposition std { year 1998, month 3, day 31 }, class "Calcium-Binding Protein", compound { "Crystal Structure Of Calsequestrin From Rabbit Skeletal Muscle Sarcoplasmic Reticulum At 2.4 A Resolution" }, source { "Mol_id: 1; Organism_scientific: Oryctolagus Cuniculus; Organism_common: Rabbit; Tissue: Skeletal Muscle" } }, source { org { taxname "Oryctolagus cuniculus", db { { db "taxon", tag id 9986 } }, orgname { name binomial { genus "Oryctolagus", species "cuniculus" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria; Lagomorpha; Leporidae; Oryctolagus", gcode 1, mgcode 2, div "MAM" } } } }, inst { repr raw, mol aa, length 367, seq-data iupacaa "EEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQ FEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEEDSIYVFKEDEVIEYDGEFSADTLVEFLLDVLEDPVE LIEGERELQAFENIEDEIKLIGYFKNKDSEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPV TIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILKSVAQDNTDNPDLSI IWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDEDDD DDDDD" }, annot { { data ids { general { db "mmdb", tag id 9767 } } } } }, seq { id { pdb { mol "1B9Y", chain 67 }, gi 4558035 }, descr { title "Chain C, Structural Analysis Of Phosducin And Its Phosphorylation- Regulated Interaction With Transducin Beta-Gamma", source { org { taxname "Rattus norvegicus", common "Norway rat", db { { db "taxon", tag id 10116 } } } } }, inst { repr raw, mol aa, length 246, seq-data ncbistdaa '0C05050101110F110B0505040605070F01120812070E0A07 13090D0414100A060A0B05110504070411090E0E110A0A05090B100F0C11110E0F111004040A04 110A05100C11100A0C11090F0516050B09080F040A05040507030B100A1610100F030C0F040C08 0F0A0B1106070E101607061316050B051207050F060B051209050A050F0A1312120913130D0916 0504071310070304010B0D11110B05030B010105160E0C130A06030A091001110D120701070410 06111104130B0E120B0B13160A0707050B09110D0609111301050F060105040606010104130511 060B0D0516070B0B0E0510050908040B070F120D12050405040905'H }, annot { { data ids { general { db "mmdb", tag id 17453 } } } } }, seq { id { pdb { mol "1BYE", chain 68 }, gi 3891708 }, descr { title "Chain D, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate", source { org { taxname "Zea mays", common "maize", db { { db "taxon", tag id 4577 } } } } }, inst { repr raw, mol aa, length 213, seq-data ncbistdaa '010E0C0A0B160701130C11140D0B1210030112010B050501 071104160509130E090D0601120105080A110E05080B13100D0E06070F130E010B0F0407040B16 0B060511100109030A160101100A0D0A0E050B0B1005070D0B050501010C130413140905130501 0D0F161201010B0D0E090B060F130B09110E0C0B07071212040F0A131304050D0B050A0B0A0A13 0B0513160501100B120A030A160B010704060B110B01040B0D08131113120B030B0601120E1601 11130B0401160E08130A01141411070B0C05100E11130F0A1301010B0C0A0E1101'H }, annot { { data ids { general { db "mmdb", tag id 8738 } } } } }, seq { id { pdb { mol "1DSB", chain 65 }, gi 493982 }, descr { title "Chain A, Dsba (Disulfide Bond Formation Protein)", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 189, seq-data ncbistdaa '010F160504070A0F1612120B050A0E130107010E0F130B05 0606110606030E0803160F060505130B080911040D130A0A0A0B0E0507130A0C120A1608130D06 0C0707040B070A040B120F01140113010C010B071305040A1312130E0B060507130F0A120F1209 10110111040910041306090D0107090A07050516040101140D110613130A110B13010F0F050A01 010104130F0B1007130E010C06130D070A160F0B0D0E0F070C0412110D0C041306130F0F160104 12130A160B11050A0A'H }, annot { { data ids { general { db "mmdb", tag id 804 } } } } }, seq { id { pdb { mol "1E6B", chain 65 }, gi 14719799 }, descr { title "Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana", source { org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } } } } }, inst { repr raw, mol aa, length 221, seq-data ncbistdaa '0C010D110705050A0B0A0B16111614101111030108101310 09010B010B0A070B04160516090E130D0B0B0A07040F06041104060A0A090D0E0C0712130E010B 130407041313090D0411060109090C160B04050A160E050E0E0B0B0E10040B080A1001130D160F 010C1109130B1107090F0E080F0D0B01130910160905050A090D1305050A120114130D0D010912 0A070612010B050A0B0B130D0301070A08011207040509160B01040B060B010E0F09080701090D 10060F090D0C050E160E120B010A03160511160D050B0E01060F0D010B0E050A0F0E04010E1111 1209'H }, annot { { data ids { general { db "mmdb", tag id 16731 } } } } }, seq { id { pdb { mol "1EEJ", chain 65 }, gi 9954903 }, descr { title "Chain A, Crystal Structure Of The Protein Disulfide Bond Isomerase, Dsbc, From Escherichia Coli", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 216, seq-data ncbistdaa '04040101090F0F120B010A0C07090A111104090F0E010E13 01070C0A12130B120D1107130B1609120404070A0809090F070E0C160413110712010E130D1312 0D0A0C0B0B0A0F0B0D010B050A050C0913160A010E0F050A081309121306120409120307160308 0A0B08050F0C0104160D010B0709121310160B01060E100F070B04110401050A050C0A01091403 010A040A0D0A01060404130C01070A1113010E0111030413040901040816010B07130F0B071311 07120E0113130B110D07120B130E07160F0E0E0A050C0A05060B0405080F0A0C1211070A'H }, annot { { data ids { general { db "mmdb", tag id 13732 } } } } }, seq { id { pdb { mol "1EEM", chain 65 }, gi 10120947 }, descr { title "Chain A, Glutathione Transferase From Homo Sapiens", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 241, seq-data ncbistdaa '0C110705110110110B070A0711010E0E070E130E05071109 100916110C1006030E0601051012100B130B0A010A070910080513090D090D0B0A0D0A0E051406 060A0A0D0E06070B130E130B050D110F070F0B091605110109120305160B040501160E070A0A0B 0B0E04040E16050A01030F0A0C090B050B06110A130E110B130711060910110F0D0A0504160107 0B0A050506100A0506120A0B0505130B120D0A0A1212060607070D1109110C0904160B09140E14 0605100B05010C0A0B0D0503130408120E0A0B0A0B140C01010C0A05040E121311010B0B121105 0A04140F07060B050B160B0F0D110E0501030416070B'H }, annot { { data ids { general { db "mmdb", tag id 14166 } } } } }, seq { id { pdb { mol "1F2E", chain 68 }, gi 9257058 }, descr { title "Chain D, Structure Of Sphingomonad, Glutathione S-Transferase Complexed With Glutathione", source { org { taxname "Sphingomonas paucimobilis", common "Sphingomonas paucimobilis", db { { db "taxon", tag id 13689 } } } } }, inst { repr raw, mol aa, length 201, seq-data ncbistdaa '0C0A0B0609110E070103110B010E0809010B100512070104 060501130A13040B0113100A120501070504060B12130D0E11070A130E010B120B04110705120B 12050D0E01090B0B160901040F0D0E0111070B010E010507110B041016100B0B11100B11060B07 110506080A0106130E0B06010E0112110405010A010101010511130A0D080B01010B040A050B01 071004081601070D01061113010409160B16130C0B07140E0116130709040C0101160E010B0701 1601070A09010F100E01130701010B0A0105070B01'H }, annot { { data ids { general { db "mmdb", tag id 13639 } } } } }, seq { id { pdb { mol "1FO5", chain 65 }, gi 14278637 }, descr { title "Chain A, Solution Structure Of Reduced Mj0307", source { org { taxname "Methanocaldococcus jannaschii", common "Methanocaldococcus jannaschii", db { { db "taxon", tag id 2190 } } } } }, inst { repr raw, mol aa, length 85, seq-data ncbistdaa '0C110A130A09050B0612110E0C030E08030E01010A101313 050513010D050C0E04011305130516090D130C050D0E0F0A010C051607090C01130E120913090D 07041305060907010E120A05010B130501090A0A100B'H }, annot { { data ids { general { db "mmdb", tag id 16323 } } } } }, seq { id { pdb { mol "1FOH", chain 65, rel std { year 1998, month 3, day 26 } }, gi 3318897 }, descr { source { org { taxname "Trichosporon cutaneum", db { { db "taxon", tag id 5554 } }, orgname { name binomial { genus "Trichosporon", species "cutaneum" }, lineage "Eukaryota; Fungi; Basidiomycota; Hymenomycetes; Tremellales; mitosporic Tremellales; Trichosporon", gcode 1, mgcode 4, div "PLN" } } } }, inst { repr raw, mol aa, length 664, seq-data iupacaa "TKYSESYCDVLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKRSTKVYN GQADGLQCRTLESLKNLGLADKILSEANDMSTIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIERHILDSI AEISDTRIKVERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMSDHESTPLQFGHKTENSLFHSNLQTQEEEDANYRLPE GKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVLDAVPASNFPDIRSRCAIHSAESGSIMIIPRENN LVRFYVQLQARAEKGGRVDRTKFTPEVVIANAKKIFHPYTFDVQQLDWFTAYHIGQRVTEKFSKDERVFIAGDACHTH SPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKTYEEERHAFAQALIDFDHQFSRLFSGRPAKDVADEMGVSMDV FKEAFVKGNEFASGTAINYDENLVTDKKSSKQELAKNCVVGTRFKSQPVVRHSEGLWMHFGDRLVTDGRFRIIVFAGK ATDATQMSRIKKFSAYLDSENSVISLYTPKVSDRNSRIDVITIHSCHRDDIEMHDFPAPALHPKWQYDFIYADCDSWH HPHPKSYQAWGVDETKGAVVVVRPDGYTSLVTDLEGTAEIDRYFSGILVEPKEKSGAQTEADWTKSTA" }, annot { { data ids { general { db "mmdb", tag id 8006 } } } } }, seq { id { pdb { mol "1FOV", chain 65 }, gi 11514277 }, descr { title "Chain A, Glutaredoxin 3 From Escherichia Coli In The Fully Oxidized Form", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 82, seq-data ncbistdaa '010D13050916120A0512030E16030810010A010B0B11110A 071311060F050B0E0904070D01010A1005050C090A101107101212130E0F09060904010F080907 071604040B16010B04011007070B040E0B0B0A'H }, annot { { data ids { general { db "mmdb", tag id 14763 } } } } }, seq { id { gi 13399774, pdb { mol "1G6Y", chain 66 } }, descr { source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } } } }, title "Chain B, Crystal Structure Of The Globular Region Of The Prion Protien Ure2 From Yeast Saccharomyces Cerevisiae" }, inst { repr raw, mol aa, length 261, seq-data ncbistdaa '0C1108130516111009120A06060F050F0E0B050716120B06 11081011010E0D07060A130109130B11050B070608160D1209060B04060D0B07050810010E0506 1311130D0E0D0110130E010B090408070C040D0B11091405110701090B0B080B130D0A16160A05 12070D0E0B0B141104040B01040F110F090D01140B06060F12110708010E0C09070F010B080610 160608110F0A09011101130510161204051310101316071313050C010B0105101005010B130C05 0B0412050D0101011611010712120E0C110F1110060604160E13140B1307040A0B120901040B01 06130E140D0D131304100907090D090A0905060E0513160A14120A080C0C10100E0113090A010B 100705'H }, annot { { data ids { general { db "mmdb", tag id 15667 } } } } }, seq { id { pdb { mol "1G7E", chain 65, rel std { year 2000, month 11, day 10 } }, gi 11513363 }, descr { pdb { deposition std { year 2000, month 11, day 10 }, class "Chaperone", compound { "Nmr Structure Of N-Domain Of Erp29 Protein" }, source { "Mol_id: 1; Organism_scientific: Rattus Norvegicus; Organism_common: Rat; Expression_system: Escherichia Coli; Expression_system_common: Bacteria; Expression_system_strain: Jm109; Expression_system_vector_type: Pqe30" } }, source { org { taxname "Rattus norvegicus", common "Norway rat", db { { db "taxon", tag id 10116 } }, orgname { name binomial { genus "Rattus", species "norvegicus" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Rodentia; Sciurognathi; Muridae; Murinae; Rattus", gcode 1, mgcode 2, div "ROD" } } } }, inst { repr raw, mol aa, length 122, seq-data iupacaa "XHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSAS SDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYSGAVKVGAIQRWLKGQGVYLGM" }, annot { { data ids { general { db "mmdb", tag id 14488 } } } } }, seq { id { pdb { mol "1G7O", chain 65, rel std { year 2000, month 11, day 10 } }, gi 15826112 }, descr { pdb { deposition std { year 2000, month 11, day 10 }, class "Oxidoreductase", compound { "Nmr Solution Structure Of Reduced E. Coli Glutaredoxin 2" }, source { "Mol_id: 1; Organism_scientific: Escherichia Coli; Organism_common: Bacteria; Expression_system: Escherichia Coli; Expression_system_common: Bacteria; Expression_system_strain: Bl21(De3); Expression_system_vector_type: Plasmid; Expression_system_plasmid: Pet24a" } }, source { org { taxname "Escherichia coli", db { { db "taxon", tag id 562 } }, orgname { name binomial { genus "Escherichia", species "coli" }, lineage "Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Escherichia", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 215, seq-data iupacaa "MKLYIYDHCPYCLKARMIFGLKNIPVELHVLLNDDAETPTRMVGQKQVPI LQKDDSRYMPESMDIVHYVDKLDGKPLLTGKRSPAIEEWLRKVNGYANKLLLPRFAKSAFDEFSTPAARKYFVDKKEA SAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGELSEDDIQLFPLLRNLTLVAGINWPSRVADYRDNMAKQTQ INLLSSMAI" }, annot { { data ids { general { db "mmdb", tag id 16937 } } } } }, seq { id { pdb { mol "1GP1", chain 65 }, gi 229946 }, descr { title "Chain A, Glutathione Peroxidase (E.C.1.11.1.9)", source { org { taxname "Bos taurus", common "cow", db { { db "taxon", tag id 9913 } } } } }, inst { repr raw, mol aa, length 198, seq-data ncbistdaa '0101010B010101010E1012131601061101100E0B01070705 0E060D0B11110B10070A130B0B09050D1301110B1507121213100416120F0C0D040B0F10100B07 0E10070B13130B07060E030D0F0607080F050D010A0D0505090B0D030B0A1613100E0707070605 0E0D060C0B06050A0305130D07050A01080E0B0601060B1005130B0E120E1104040112010B0C12 040E0A06091214110E1303100D041311140D06050A060B13070E0407130E13101016111010060B 12090409050E040905120B0B110F07011101'H }, annot { { data ids { general { db "mmdb", tag id 1076 } } } } }, seq { id { gi 1127145, pdb { mol "1GSE", chain 66 } }, descr { source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } }, title "Chain B, Glutathione Transferase A1-1 Complexed With An Ethacrynic Acid Glutathione Conjugate (Mutant R15k)" }, inst { repr raw, mol aa, length 221, seq-data ncbistdaa '01050A0E0A0B0816060D0110070A0C05111210140B0B0101 010713050605050A06090A110105040B040A0B100D0407160B0C060F0F130E0C13050904070C0A 0B130F121001090B0D160901110A160D0B16070A04090A0510010B09040C160905070901040B07 050C090B0B0B0E13030E0E05050A04010A0B010B090A050A090A0D1016060E0106050A130B0A11 08070F04160B13070D0A0B1110010409080B13050B0B16161305050B0411110B091111060E0B0B 0A010B0A121009110D0B0E12130A0A060B0F0E07110E100A0E0E0C04050A110B050501100A0906 1006'H }, annot { { data ids { general { db "mmdb", tag id 3749 } } } } }, seq { id { pdb { mol "1H75", chain 65 }, gi 15825737 }, descr { title "Chain A, Structural Basis For The Thioredoxin-Like Activity Profile Of The Glutaredoxin-Like Protein Nrdh-Redoxin From Escherichia Coli.", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 81, seq-data ncbistdaa '0C100912091612100D0403130F030801120A10010C050D10 07060406050C090D130410130E05010105010B10010F0706100F0B0E1313090107040B11141107 06100E040C090D100B080E010E0801011101'H }, annot { { data ids { general { db "mmdb", tag id 16786 } } } } }, seq { id { pdb { mol "1HYU", chain 65, rel std { year 2001, month 1, day 22 } }, gi 13399974 }, descr { pdb { deposition std { year 2001, month 1, day 22 }, class "Oxidoreductase", compound { "Crystal Structure Of Intact Ahpf" }, source { "Mol_id: 1; Organism_scientific: Salmonella Typhimurium; Organism_common: Bacteria; Expression_system: Escherichia Coli; Expression_system_common: Bacteria" } }, source { org { taxname "Salmonella typhimurium", db { { db "taxon", tag id 602 } }, orgname { name binomial { genus "Salmonella", species "typhimurium" }, lineage "Bacteria; Proteobacteria; gamma subdivision; Enterobacteriaceae; Salmonella", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 521, seq-data iupacaa "MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKV TFKEDNTLPVRKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRDIDGDFEFETYYSLS CHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKEFGQGRMTLTEIVAKVDTGAEKRAAEA LNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGLMGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDV IDSQSASKLVPAATEGGLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIG GGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSV ALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRT KIA" }, annot { { data ids { general { db "mmdb", tag id 15718 } } } } }, seq { id { pdb { mol "1IYI", chain 68 }, gi 30749305 }, descr { title "Chain D, Crystal Structure Of Hematopoietic Prostaglandin D Synthase", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 198, seq-data ncbistdaa '0E0D160A0B1216060D0C100710010509091016090601160B 04090F160504081009050F0104140E05090A11120B0E06070A090E090B051304070B120B080F11 0B01090110160B120A0D12040B01070D12050C050F0308130401091304120B0404060C1103060E 1401050A0A0F04130A050F0C060D050B0B12160D010E080B0C0F040B0412160B07071005140B09 070C1113121401040616140509031112120B0B13060A0E040B0B040D080E100B13120B100A0A13 0F01090E0113010D14090A10100E0F120A0B'H }, annot { { data ids { general { db "mmdb", tag id 22561 } } } } }, seq { id { pdb { mol "1J9B", chain 65 }, gi 17943113 }, descr { title "Chain A, Arsenate Reductase+0.4m Arsenite From E. Coli", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 141, seq-data ncbistdaa '0C110D09120916080D0E0115071211100D120B050C09100D 110712050E1209090B160B050D0E0E111004050B130A0B0901040C0709111310010B0B100A0D13 050E16050F0B070B0105040A061204040F0B0904060C0B0F080E090B090D100E091313120E0B07 12100B03100E110513130B04090B0F04010F0A070106120A050407050A1313040501070A100B0A 'H }, annot { { data ids { general { db "mmdb", tag id 18089 } } } } }, seq { id { pdb { mol "1JFU", chain 65 }, gi 15988313 }, descr { title "Chain A, Crystal Structure Of The Soluble Domain Of Tlpa From Bradyrhizobium Japonicum", source { org { taxname "Bradyrhizobium japonicum", common "Bradyrhizobium japonicum", db { { db "taxon", tag id 375 } } } } }, inst { repr raw, mol aa, length 186, seq-data ncbistdaa '1110010E1207040E0103100101130112010F0A09010E0B01 0807051301010B120C0111010E0B0A0B0E040B010605040104070A0E0A0A0B11040610070A120B 0B130D0B1401121403130E03100A050C0E010B04050B0F070A0B11070E0D0605131301090D0904 1210040E050A0E0A12060B0A05010D0B12100B0716060D040F0A010A13060F040B0A0109071001 0B070C0E1211130B13040E0F0703050901120901070E01051401110504010B0A0B091001011207 0A010101010B'H }, annot { { data ids { general { db "mmdb", tag id 17353 } } } } }, seq { id { pdb { mol "1K0N", chain 65, rel std { year 2001, month 9, day 19 } }, gi 17943343 }, descr { source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 241, seq-data iupacaa "MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKR RTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDN LEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGV HRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK" }, annot { { data ids { general { db "mmdb", tag id 18161 } } } } }, seq { id { pdb { mol "1KNG", chain 65 }, gi 22219063 }, descr { title "Chain A, Crystal Structure Of Ccmg Reducing Oxidoreductase At 1.14 A", source { org { taxname "Bradyrhizobium japonicum", common "Bradyrhizobium japonicum", db { { db "taxon", tag id 375 } } } } }, inst { repr raw, mol aa, length 156, seq-data ncbistdaa '040E1110090E11010B0907100E010E0F12010B0E0E0B0507 0B0F01040D130F130E070B040E0101060A070A13110B130D131401111403130E03080405010E0B 0B12050B070A040A10060F0B1307090D160A040101040D011010060B071016070D0E0607101307 1304010D0710011109051407131607130E051206131307100507120913160A0B13070E09120E04 0D0B1011130B0B0E0F0C050A010B0A'H }, annot { { data ids { general { db "mmdb", tag id 20174 } } } } }, seq { id { pdb { mol "1KTE" }, gi 1827634 }, descr { title "Crystal Structure Of Thioltransferase At 2.2 Angstrom Resolution", source { org { taxname "Sus scrofa", common "pig", db { { db "taxon", tag id 9823 } } } } }, inst { repr raw, mol aa, length 105, seq-data ncbistdaa '010F0106130D110A090F0E070A13131306090A0E12030E06 03100A120F050B0B110F0B0E060A05070B0B05061304091201121104120D05090F04160B0F0F0B 1207011012130E10130609070A05030907070312040B05110C080A1007050B0B12100B0F0F1307 01130A'H }, annot { { data ids { general { db "mmdb", tag id 4783 } } } } }, seq { id { pdb { mol "1LU4", chain 65 }, gi 38492424 }, descr { title "Chain A, 1.1 Angstrom Resolution Crystal Structure Of A Secreted Mycobacterium Tuberculosis Disulfide Oxidoreductase Homologous To E. Coli Dsbe: Implications For Functions", source { org { taxname "Mycobacterium tuberculosis", common "Mycobacterium tuberculosis", db { { db "taxon", tag id 1773 } } } } }, inst { repr raw, mol aa, length 136, seq-data ncbistdaa '010405100B0F06120112120B1107010E06040701110B0F07 0A0E01130B140614120E14030E06030D0105010E110B110F130101010D0E011312061307090112 1001041307010C0F110613110A160D0B0D06120D0B0D040104071309140110160D130E140F0E01 061306161001040712111206130D0D0E1201010C110F04050B1107101301010B1211'H }, annot { { data ids { general { db "mmdb", tag id 24926 } } } } }, seq { id { pdb { mol "1M2A", chain 65, rel std { year 2002, month 6, day 22 } }, gi 24158927 }, descr { source { org { taxname "Aquifex aeolicus", db { { db "taxon", tag id 63363 } }, orgname { name binomial { genus "Aquifex", species "aeolicus" }, lineage "Bacteria; Aquificae; Aquificales; Aquificaceae; Aquifex", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 110, seq-data iupacaa "AEFKHVFVCVQDRPPGHPQGSCAQRGSREVFQAFMEKIQTDPQLFMTTVI TPTGCMNACMMGPVVVVYPDGVWYGQVKPEDVDEIVEKHLKGGEPVERLVISKGKPPGMF" }, annot { { data ids { general { db "mmdb", tag id 20686 } } } } }, seq { id { pdb { mol "1NHY", chain 65, rel std { year 2002, month 12, day 20 } }, gi 28374020 }, descr { pdb { deposition std { year 2002, month 12, day 20 }, class "Translation", compound { "Crystal Structure Of The Gst-Like Domain Of Elongation Factor 1-Gamma From Saccharomyces Cerevisiae." }, source { "Mol_id: 1; Organism_scientific: Saccharomyces Cerevisiae; Organism_common: Yeast; Gene: Tef3; Expression_system: Escherichia Coli; Expression_system_common: Bacteria; Expression_system_strain: Bl21; Expression_system_vector_type: Plasmid; Expression_system_plasmid: Pet11d" } }, source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } }, orgname { name binomial { genus "Saccharomyces", species "cerevisiae" }, lineage "Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces", gcode 1, mgcode 3, div "PLN" } } } }, inst { repr raw, mol aa, length 219, seq-data iupacaa "XSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVP AFVGPKGYKLTEAXAINYYLVKLSQDDKXKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKS VDSAXDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEYK DFKFADKPLSPPQ" }, annot { { data ids { general { db "mmdb", tag id 21878 } } } } }, seq { id { pdb { mol "1NM3", chain 66 }, gi 29726704 }, descr { title "Chain B, Crystal Structure Of Heamophilus Influenza Hybrid-Prx5", source { org { taxname "Haemophilus influenzae", common "Haemophilus influenzae", db { { db "taxon", tag id 727 } } } } }, inst { repr raw, mol aa, length 241, seq-data ncbistdaa '1511111505070A0A130E0F1312061012100F07040A141304 13121211050B06040D0A1213091306110B0E070106120E1203111111080B0E10160D050B010E13 060A0A1607130404090B131311130D04120613150D01140A0504050A11050D091106090E04070D 0705061205071507150B13070A05040B0706070A101114101611150B130A0D071313050A150609 050E0D050E07040E060A131104010412150B0A160B010E0F080F130F051109110906120A0E0703 0E0603010A010A0F0B0B08040A070B1106050509090B0708040112091311131001131107101212 130E0F13060907070A080907071104040B050A160601'H }, annot { { data ids { general { db "mmdb", tag id 22408 } } } } }, seq { id { pdb { mol "1O73", chain 65 }, gi 30749845 }, descr { title "Chain A, Tryparedoxin From Trypanosoma Brucei", source { org { taxname "Trypanosoma brucei brucei", common "Trypanosoma brucei brucei", db { { db "taxon", tag id 5702 } } } } }, inst { repr raw, mol aa, length 144, seq-data ncbistdaa '0C11070B010A160B0E0701120D0B0B110A11070513110B07 110B13070A1213060B160611011114030E0E03100706120E130B01050616050A080813010A0D06 0513130B09111404050D0511040608041616070A0C0E140B010B0E06040F1011121311050B070A 120607130511090E120B0912090D0104120701090907120F01101210130905040E0407010D060E 140E0D'H }, annot { { data ids { general { db "mmdb", tag id 22771 } } } } }, seq { id { pdb { mol "1OC3", chain 66, rel std { year 2003, month 2, day 5 } }, gi 46015019 }, descr { source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 172, seq-data iupacaa "RGSHHHHHHGSAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGV PGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLV SIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL" }, annot { { data ids { general { db "mmdb", tag id 26393 } } } } }, seq { id { pdb { mol "1ON4", chain 65 }, gi 39654376 }, descr { title "Chain A, Solution Structure Of Soluble Domain Of Sco1 From Bacillus Subtilis", source { org { taxname "Bacillus subtilis", common "Bacillus subtilis", db { { db "taxon", tag id 1423 } } } } }, inst { repr raw, mol aa, length 174, seq-data ncbistdaa '080C0B05090A040E0B0D160513050E0612060F0D0F04070A 0D13110B05110B0A070513140B0104060906120D03051209030E0E0C1201080C12040B0F0A0A0B 0A01050D09041310090911061113040E050D040A0E0A0F0B0A0A0601010D160E0B1106040D1404 060B120716110F110509050506010B0A11060A0109130A0A0E050705040F1309080F111106160B 13070E04070A130B0A04160D0713050D120E16040409091104130A110111120B0A'H }, annot { { data ids { general { db "mmdb", tag id 25298 } } } } }, seq { id { pdb { mol "1OYJ", chain 68 }, gi 33357809 }, descr { title "Chain D, Crystal Structure Solution Of Rice Gst1 (Osgstu1) In Complex With Glutathione.", source { org { taxname "Oryza sativa", common "rice", db { { db "taxon", tag id 4530 } } } } }, inst { repr raw, mol aa, length 231, seq-data ncbistdaa '0C0105050A050B130B0B04061413110E06070F1003100901 0C01050A070B05060516100505040B070D0A11040B0B0B10110D0E1308100A090E130B0B080107 100E131105110B13090B0F160B040401060E07120E080B0B0E0E010D1107040104010116011001 12011006140104161304100A0B1604030711100B14100B0A07050E0F0101010710050C0105090B 10120B0501050B070410050606070707070707100B0706130413010B130E061201140616111605 10030707061113050513010E100B01011401101003071009041113130A080B0E110E050A131604 061307130B0A0A0A16071305'H }, annot { { data ids { general { db "mmdb", tag id 23571 } } } } }, seq { id { pdb { mol "1PRX", chain 65 }, gi 3318841 }, descr { title "Chain A, Horf6 A Novel Human Peroxidase Enzyme", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 224, seq-data ncbistdaa '0C0E07070B0B0B070413010E0D0605010D12121307100910 060804060B0704111407090B0611080E100406120E13151212050B071001010A0B010E0506010A 100D130A0B09010B11090411130504080B0114110A04090D01160D1105050E12050A0B0E060E09 090404100D10050B01090B0B070C0B040E01050A04050A070C0E131201101313061306070E040A 0A0B0A0B11090B160E01121207100D060405090B10131309110B0F0B1201050A101301120E1304 140A04070411130C130B0E12090E050505010A0A0B060E0A071306120A050B0E11070A0A160B10 16120E0F0E'H }, annot { { data ids { general { db "mmdb", tag id 7978 } } } } }, seq { id { pdb { mol "1PSQ", chain 66 }, gi 33358146 }, descr { title "Chain B, Structure Of A Probable Thiol Peroxidase From Streptococcus Pneumoniae", source { org { taxname "Streptococcus pneumoniae", common "Streptococcus pneumoniae", db { { db "taxon", tag id 1313 } } } } }, inst { repr raw, mol aa, length 163, seq-data ncbistdaa '151312060B070D0E13110612070A0F0B0F1307040A010B04 06110B121212040B110A0A110B01040604070A0A0A130B1113130E1109041207090311120F1210 10060D05050B01070B040D1213130B12131115040B0E06010F0A101403070105070B040D010915 0B110416060408110607100416010B0B090D0514080B0B0110011306130B0412040D1209101613 051613040D090D11050E0D06050101090101010A010B'H }, annot { { data ids { general { db "mmdb", tag id 23664 } } } } }, seq { id { pdb { mol "1QGV", chain 65, rel std { year 1999, month 5, day 6 } }, gi 6730460 }, descr { pdb { deposition std { year 1999, month 5, day 6 }, class "Transcription", compound { "Human Spliceosomal Protein U5-15kd" }, source { "Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Cell_line: Hela; Cellular_location: Nucleus; Gene: U5-15kd; Expression_system: Escherichia Coli; Expression_system_strain: Tap106; Expression_system_cellular_location: Cytoplasm; Expression_system_vector_type: Plasmid; Expression_system_vector: Pxc35; Expression_system_plasmid: Pxc35-15k; Expression_system_gene: U5-15kd" } }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 142, seq-data iupacaa "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAE KVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG LVVSPKDYSTKYRY" }, annot { { data ids { general { db "mmdb", tag id 11831 } } } } }, seq { id { pdb { mol "1QMV", chain 65 }, gi 9955007 }, descr { title "Chain A, Thioredoxin Peroxidase B From Red Blood Cells", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 197, seq-data ncbistdaa '1511070D011009070A0E010E04060A011201131304070106 0A05130A0B1104160A070A1613130B0606160E0B0406120613150E120509090106110D10010504 06100A0B070305130B0713111304110F0612080B0114090D120E100A0507070B070E0B0D090E0B 0B0104131210100B1105041607130B0A1204050709011610070B06090904070A07130B100F0912 130D040B0E13071011130405010B100B130F01060F1612040508070513030E0107140A0E071104 12090A0E0D130404110A051606110A080D'H }, annot { { data ids { general { db "mmdb", tag id 13774 } } } } }, seq { id { pdb { mol "1R4W", chain 65 }, gi 42543493 }, descr { title "Chain A, Crystal Structure Of Mitochondrial Class Kappa Glutathione Transferase", source { org { taxname "Rattus norvegicus", common "Norway rat", db { { db "taxon", tag id 10116 } } } } }, inst { repr raw, mol aa, length 226, seq-data ncbistdaa '0C070E010E10130B050B061604130B110E1611140B070605 130B0310160F080B140D090A0B0A0B100E010B0B0107090C0A0411070D0F0E0E010C130E080A07 0F16090B0A05090E0B0B0A0F0B060F130E0C11130E0A040606070508130A0A0712130D010C1006 0B120113110C050F0E050C0B050A131110050B140C1009141110040504091205110F0D090B1101 01050A01070C0112010F010F080B0B0D0A091112050B130A110A0B10051212070101030A160701 06070B0E12121301081304070A12160C0B06071104100C050B0B01160B0B07050A140C070E130E 0E120B0D01100B'H }, annot { { data ids { general { db "mmdb", tag id 26163 } } } } }, seq { id { pdb { mol "1RW1", chain 65 }, gi 56553692 }, descr { title "Chain A, Yffb (Pa3664) Protein", source { org { taxname "Pseudomonas aeruginosa PAO1", common "Pseudomonas aeruginosa PAO1", db { { db "taxon", tag id 208964 } } } } }, inst { repr raw, mol aa, length 114, seq-data ncbistdaa '1216130B1607090A01030412150A0A011012140B0405080A 13011604060804160A01130709041005080B1010140301050807140F12130B0D10010712120610 0A0B0405010F0A01040B0405010A0109050B150B010F0E1115090A100E130B050B070710120B13 07060A0E0401160101010B01'H }, annot { { data ids { general { db "mmdb", tag id 29873 } } } } }, seq { id { pdb { mol "1SEN", chain 65 }, gi 51247348 }, descr { title "Chain A, Endoplasmic Reticulum Protein Rp19 O95881", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 164, seq-data ncbistdaa '0C070711080808080808070C011111110407080D070B070A 070607040809081410120B0504070A0A0501010111070B0E0B0C130909080A1114030701030A01 0B0A0E0A0601051112050911050B11080D06130C130D0B05040505050E0A04050406110E040707 16090E10090B060B040E11070A13080E0509090D050D070D0E11160A160616131101050F13130F 070C0A05010F05100B1207040106100A0A080B0504050B'H }, annot { { data ids { general { db "mmdb", tag id 28565 } } } } }, seq { id { pdb { mol "1T1V", chain 66 }, gi 50513694 }, descr { title "Chain B, Crystal Structure Of The Glutaredoxin-Like Protein Sh3bgrl3 At 1.6 A Resolution", source { org { taxname "Mus musculus", common "house mouse", db { { db "taxon", tag id 10090 } } } } }, inst { repr raw, mol aa, length 93, seq-data ncbistdaa '0C11070B101316111211131207111005090A110F0F110513 1210090B04070A10090F160F0B130409110F040D010B1004050C10120B01070D0E0A01120E0E0F 09130D070D081603070416050B0613050113050F04120B0F05060B0A0B01'H }, annot { { data ids { general { db "mmdb", tag id 28302 } } } } }, seq { id { pdb { mol "1T4Z", chain 65, rel std { year 2007, month 8, day 27 } }, gi 159163046 }, descr { source { org { taxname "Synechococcus elongatus", db { { db "taxon", tag id 32046 } }, orgname { name binomial { genus "Synechococcus", species "elongatus" }, lineage "Bacteria; Cyanobacteria; Chroococcales; Synechococcus", gcode 11, div "BCT" } } }, title "Solution Structure Of The N-Terminal Domain Of Synechococcus Elongatus Sasa (25-Structures Ensemble)" }, inst { repr raw, mol aa, length 105, seq-data ncbieaa "GSSLSPQALAQPLLLQLFVDTRPLSQHIVQRVKNILAAVEATVPISLQVI NVADQPQLVEYYRLVVTPALVKIGPGSRQVLSGIDLTDQLANQLPQWLVQQEGIF" }, annot { { data ids { general { db "mmdb", tag id 30303 } } } } }, seq { id { pdb { mol "1UC7", chain 65 }, gi 48425782 }, descr { title "Chain A, Crystal Structure Of Dsbdgamma", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 125, seq-data ncbistdaa '12010F120F12080B0D06120F090A121304050B0D0F010B13 05010A070A0E130C0B040B16010414031301030A0506050A16120611040E0F130F0A010B010412 130B0B0F010D1312010D04010F0413010B0B0A080B0D130B070B0E12090B060604070F070F0508 0E0F0110131207060C04010512061101080B1004100F0E'H }, annot { { data ids { general { db "mmdb", tag id 27473 } } } } }, seq { id { pdb { mol "1V2A", chain 68 }, gi 38493130 }, descr { title "Chain D, Glutathione S-Transferase 1-6 From Anopheles Dirus Species B", source { org { taxname "Anopheles dirus", common "Anopheles dirus", db { { db "taxon", tag id 7168 } } } } }, inst { repr raw, mol aa, length 210, seq-data ncbistdaa '0C04161616110B09110E0E030F1101090B0B010A0A0B0709 120B0D0B0A0A120D1308040E13051004010B120A0B0D0E0F0812090E120B13040D070813131405 11160109130B160B13051216010A0404120B160E0A040E0A13101113130D0F100B060604090712 0B160A100909041309080B130C0A0A050F0E1104050F0C050A0B0A07010B040B0B050F06131205 10011601010104080B1213010409030B0B07121312010B0D140B0A08040B050E060E0809100114 0B0510131001050C0E0416050506110A0F13010404120B0116130111100A'H }, annot { { data ids { general { db "mmdb", tag id 25177 } } } } }, seq { id { pdb { mol "1WIK", chain 65, rel std { year 2007, month 8, day 27 } }, gi 159163386 }, descr { source { org { taxname "Mus musculus", common "house mouse", db { { db "taxon", tag id 10090 } }, syn { "mouse" }, orgname { name binomial { genus "Mus", species "musculus" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Mus", gcode 1, mgcode 2, div "ROD" } } }, title "Solution Structure Of The Picot Homology 2 Domain Of The Mouse Pkc-Interacting Cousin Of Thioredoxin Protein" }, inst { repr raw, mol aa, length 109, seq-data ncbieaa "GSSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETF DILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGESGPSSG" }, annot { { data ids { general { db "mmdb", tag id 30599 } } } } }, seq { id { pdb { mol "1WOU", chain 65, rel std { year 2004, month 8, day 25 } }, gi 55670733 }, descr { pdb { deposition std { year 2004, month 8, day 25 }, class "Electron Transport", compound { "Crystal Structure Of Human Trp14" }, source { "Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Expression_system: Escherichia Coli; Expression_system_common: Bacteria; Expression_system_vector_type: Plasmid; Expression_system_plasmid: Pet11a" } }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 123, seq-data iupacaa "MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAE PVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED" }, annot { { data ids { general { db "mmdb", tag id 29770 } } } } }, seq { id { gi 61680454, pdb { mol "1XVW", chain 66 } }, descr { source { org { taxname "Mycobacterium tuberculosis", common "Mycobacterium tuberculosis", db { { db "taxon", tag id 1773 } } } }, title "Chain B, Crystal Structure Of Ahpe From Mycobacterium Tuberculosis, A 1-Cys Peroxiredoxin" }, inst { repr raw, mol aa, length 160, seq-data ncbistdaa '0A130E100711080C0B0D13070112010E0406120B10040F0D 0F0F0B13120B1007161007010A0D130B0B1306060E0B0106120709150F07050B040F0B1004080B 0E0506050D04041101010B01091113070E0E0E12080A091401120F11070612060E0B0B11040614 0E08070113110F01160713060D050F010709010D100712061313041011070909100601050C0A0F 0E07051310040F100B141204010B01010B1201'H }, annot { { data ids { general { db "mmdb", tag id 31994 } } } } }, seq { id { pdb { mol "1XW5", chain 66 }, gi 56967268 }, descr { title "Chain B, Human Glutathione S-Transferase M2-2 (E.C.2.5.1.18)comlexed With Glutathione, Monoclinic Crystal Form", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 217, seq-data ncbistdaa '0E0C120B0716140D0910070B01081109100B0B0B05161204 11111605050A0A16120C0704010E04160410110F140B0D050A060A0B070B04060E0D0B0E160B09 040712080A09120F110D01090B10160901100A080D0B03070511050A050F09100504090B050D0F 060C0411100C0F0B010A0B0316040E0406050A0B0A0E05160B0F010B0E050C0B0A0B16110F060B 070A0F0E14060B07040A09120613040609011604130B05100D0F1306050E11030B0401060E0D0B 0A04060911100605070B050A091101160C0A111110060B0E100E1306120A0C011314070D0A'H }, annot { { data ids { general { db "mmdb", tag id 30760 } } } } }, seq { id { pdb { mol "1YY7", chain 65, rel std { year 2005, month 2, day 23 } }, gi 61680862 }, descr { source { org { taxname "Yersinia pestis", db { { db "taxon", tag id 632 } }, orgname { name binomial { genus "Yersinia", species "pestis" }, lineage "Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Yersinia", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 213, seq-data iupacaa "MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDL IDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQGNAQEAEAA RKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAERE MHLKTRS" }, annot { { data ids { general { db "mmdb", tag id 32164 } } } } }, seq { id { gi 67464379, pdb { mol "1Z9H", chain 68 } }, descr { source { org { taxname "Macaca fascicularis", common "crab-eating macaque", db { { db "taxon", tag id 9541 } } } }, title "Chain D, Microsomal Prostaglandin E Synthase Type-2" }, inst { repr raw, mol aa, length 290, seq-data ncbistdaa '05101101130F0B110B1111100B0F0B120B160F160A12030E 0603110A131001060B040608010B0E160F131305130D0E130B100105090A06111116100A130E09 0B13010F05070511110F0F0B0D04111113090911010B0A12160B1311070F0E0B05050909121616 0E010C0A01130D040F070A0513120506070D0A16140B0C0B0D050A05010F0F131611070A050110 1205050C0A14100F14010404140B13080B09110E0D131610120E1205010B011106041609131005 070A0607011305070113010A160C070101010C160B09110A100B0A111008100B0F040D13100504 0B16050101040A1413010113070A04100E060C07070F0A0E0D0B01040B01131607130B10130C05 070B04010604040B0C0F081208090F0E14160B101305100109120501110E0108'H }, annot { { data ids { general { db "mmdb", tag id 33380 } } } } }, seq { id { pdb { mol "2BJX", chain 65, rel std { year 1999, month 1, day 30 } }, gi 4558335 }, descr { pdb { deposition std { year 1999, month 1, day 30 }, class "Electron Transport", compound { "Protein Disulfide Isomerase" }, source { "Mol_id: 1; Organism_scientific: Homo Sapiens; Organism_common: Human; Strain: Bl21 (De3); Expression_system: Escherichia Coli; Expression_system_strain: Bl21 (De3); Expression_system_plasmid: Pet12a" } }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } } }, inst { repr raw, mol aa, length 110, seq-data iupacaa "AATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFG ITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTA" }, annot { { data ids { general { db "mmdb", tag id 9693 } } } } }, seq { id { pdb { mol "3LJR", chain 66 }, gi 4699801 }, descr { title "Chain B, Glutathione Transferase (Theta Class) From Human In Complex With The Glutathione Conjugate Of 1-Menaphthyl Sulfate", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 244, seq-data ncbistdaa '0C070B050B060B040B13110F0E11100113160906010A0A0D 07090E0B050B101213040B130A070F080A110A05060B0F090D110B070A0B0E120B0A0407040609 0B1205111101090B09160B11030A160F120E040814160E11040B0F01100110130805160B071408 010403091007120607090E0B14130F130B070E0B0907130F130E05050A1305100D1012010C040F 010B0F140B05040A060B0704100E060B01070F0F13120B01040B0C010B05050B0C0F0E13010B07 16050B060507100E100B010114100710130501060B0701050B030F0501081109090B11090B050F 01010A0A120B0E120E110E0501160F010C0B0B10090110090E'H }, annot { { data ids { general { db "mmdb", tag id 9863 } } } } }, seq { id { pdb { mol "3PGT", chain 66 }, gi 5822522 }, descr { title "Chain B, Crystal Structure Of Hgstp1-1[i104] Complexed With The Gsh Conjugate Of (+)-Anti-Bpde", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 210, seq-data ncbistdaa '0C0E0E1612131316060E131007100301010B100C0B0B0104 0F070F11140A0505131312130512140F0507110B0A0111030B16070F0B0E0A060F0407040B120B 160F110D12090B10080B0710120B070B16070A040F0F0501010B13040C130D04071305040B1003 0A1609110B0916120D160501070A040416130A010B0E070F0B0A0E0605120B0B110F0D0F07070A 1206091307040F0911060104160D0B0B040B0B0B090805130B010E07030B0401060E0B0B110116 1307100B1101100E0A0B0A01060B01110E0516130D0B0E090D070D070A0F'H }, annot { { data ids { general { db "mmdb", tag id 11040 } } } } }, seq { id { swissprot { name "PDIA4_HUMAN", accession "P13667" }, gi 119530 }, descr { title "Protein disulfide-isomerase A4 precursor (Protein ERp-72) (ERp72)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 645, seq-data ncbistdaa '0C100E100A01060B0B0B0B0B0B070B130F0B0B0113010701 05070E04050411110D10050D010905040505050505050504040405050504040B05130A05050D07 130B130B0D04010D06040D061301040A0412130B0B050616010E14030708030A0F06010E051605 0A09010D090B0A040A040E0E090E13010A09040112110111130B0111100604131107160E12090A 090B0A0A070F0113041605071110120F05050913010A13100513110F0E0414120E0E0E0513120B 130B120A050D06040513130D04010409090B13050616010E14030708030A0A0B010E0516050A01 010A050B110A10110E0E090E0B010A13040112010512040B010A100604131107160E120B0A0906 100A07100E1604160D070E10050A1607091304160C09050F11070E0E110A05090B120B0A0F130F 05060B0A04070404130909090713060A070511040E01160F0F160F0401010D0D0B100504160A06 0808120611120509010A060B0A13110F070F0B13130C0F0E050A060F110A16050E1011080C0C04 130F0711120F041101090A0406130B0A16010B0E0B130708100A13110D04010A10161210100E0B 13131316161113040611060416100101120F061410110A130B0513010A04060E05161206010901 0405050416010705130A040B070B110511070504130D0101090B040511070A0A06010C050E0505 06041104120B100506131201060A0A070A0B0A0E13090A110F0E130E0A0D0D0A070E130A131313 070A1206041109130C040E0A0A04130B09050616010E14030708030A0F0B050E13160D110B010A 0A160A070F0A070B1309010A0C040112010D04130E110410160A130507060E12091606010E1107 040A0A0D0E130A060507070410040B05080B110A060905050801120A0B1110120A05050B'H } }, seq { id { swissprot { name "HOXF_ALCEU", accession "P22317" }, gi 123467 }, descr { title "NAD-reducing hydrogenase hoxS alpha subunit", source { org { taxname "Cupriavidus necator", common "Cupriavidus necator", db { { db "taxon", tag id 106590 } } } } }, inst { repr raw, mol aa, length 602, seq-data ncbistdaa '0C041110091212090B0510161011041012100B0904090B14 04130F0805160708090E0401130B0E0F0B0701070B0A0B110E0B0409100512011106160806060B 040A0E11070A161009160B030D111309010A090D07160F01131005010B05100512070910060705 12040E0D070C06070B0604120E0309070B11040F050E010C0B09040A13130612100B100E070A09 12040909010F0B0A0F0710110E010509010D0E01070B0E110F040901161304010C1305110D1310 120A070E13060610071012040B10110B0B040F030B0B0B0A0E050F1309051209130411100B1007 1007070107061112070B0A14100B031004010511050F0A161309030D01040507050E0712060A04 10130B0B1210010E0A0A130613070C130901011601090703100A070913160B1007051606160B0A 04160B05100F0B0F050B100504070B0B071001090707100107060406040910090F0C0701070116 090307040511010B0905110305070A1007120E10130A0E0E060E130F0F07160B070A0E1211130D 0D130512060101131110090C0505070104140610010C07120E0411010712100B0B111301070403 110A0E070916051305140713120B0D05130B010C1307011004011001130F0911070E1107050313 1113010A040705100A0B011605040B11030D0701061209060D030A10040B0B0509131004080C0F 06061305051103070903130E031001070D13040B08100A130514130901070A01030F0A040B0404 0C13111407010B13101012111003070B070112110E0A0E090B12120B050A060E0509160F0D0A0B 13100805070E0B0B0E1106040B0412010B070716050A010B0A040B0505131210'H } }, seq { id { swissprot { name "LIGE_PSEPA", accession "P27457" }, gi 126289 }, descr { title "Beta-etherase (Beta-aryl ether cleaving enzyme)", source { org { taxname "Sphingomonas paucimobilis", common "Sphingomonas paucimobilis", db { { db "taxon", tag id 13689 } } } } }, inst { repr raw, mol aa, length 281, seq-data ncbistdaa '0C01100D0D1209120B16040B0F0B051107031209110E1613 1410120A16010B0A080A070604090409130E0707061207090B051012070710110510130E130913 0404070514130B04111413090105160B04050A160E04100E0C0B0605070E120F0A0D0B0C0A060B 040D140B1411120113070E1406100316090B041608040B110B0E0F041004161310141110050F14 060B07070F100B0504130F0107100504100B0E0B130E0E120B050E061010090B0105120A140B07 07040F0E0D0601041611010B0113060B14120111130110120E0E0B120504040E0B1004140B0410 0706040B0604070B0710080E070C0D0E0B06070B0A0B100507040E050E0613100F12070E010701 07070F010B0D0A070E0F12120A0C0E0E101301050A0104'H } }, seq { id { swissprot { name "TXLA_SYNP7", accession "P35088" }, gi 464973 }, descr { title "Thiol:disulfide interchange protein txlA", source { org { taxname "Synechococcus elongatus PCC 7942", common "Synechococcus elongatus PCC 7942", db { { db "taxon", tag id 1140 } } } } }, inst { repr raw, mol aa, length 191, seq-data ncbistdaa '0C1201040D11130E11100B100D090B13090101010B130B12 090B13130B0711100F0E11010101110B01110B01050F01120E1605130109010D04100E0C0B0B05 0616010414031211030F010C0107100901010B0A0F04161104100B0406130C0B0D09040D040A14 0B0E05130B04160D130407090E0F0613160B0D070F070F0E0F0709110907050B0E1011130B0101 0D0B04010B1305010F0E0B0E16120D0110070D0B1105061101040B0F0E111011110F12040E1011 0811070F130F0407130B04'H } }, seq { id { genbank { accession "AAC43336", version 1 }, gi 643639 }, descr { title "unknown [Burkholderia cepacia]", source { org { taxname "Burkholderia cepacia", common "Burkholderia cepacia", db { { db "taxon", tag id 292 } } } } }, inst { repr raw, mol aa, length 164, seq-data ncbistdaa '0C120D04120C0B12130B0710011211110D130F0A130C140B 0B040509070F0E03131013040C07070F0607070D0A050105160B0F0A0D0E0D0713130E120B0904 0C041213131405110D12090B10160B110D1006070106040B160E13040E1308100114090510140C 04140F0B11120B070E010D120B0B060F11091310120E0E040A101101040B090511161005100D01 0A0B0604130B040F130B01071010160B07071210040110'H } }, seq { id { genbank { accession "AAB33256", version 1 }, gibbmt 354875, gibbsq 157931, gi 707001 }, descr { update-date std { year 1995, month 3, day 13 }, molinfo { biomol peptide, tech concept-trans-a }, pub { pub { muid 95046297 }, name "pEF141", fig "Fig. 1", num cont { } }, title "Clostridium pasteurianum ferredoxin homolog [Solanum tuberosum]", update-date std { year 1995, month 3, day 13 }, source { org { taxname "Solanum tuberosum", common "potato", mod { "leaf", "cv. Cara" }, db { { db "taxon", tag id 4113 } }, orgname { name binomial { genus "Solanum", species "tuberosum" }, lineage "Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; asterids; lamiids; Solanales; Solanaceae; Solanum", gcode 1, mgcode 1, div "PLN" } } }, create-date std { year 1995, month 3, day 12 }, pub { pub { article { title { name "Characterisation of a complementary DNA encoding a novel plant enzyme with sucrolytic activity." }, authors { names std { { name name { last "Machray", initials "G.C." } }, { name name { last "Burch", initials "L." } }, { name name { last "Hedley", initials "P.E." } }, { name name { last "Davies", initials "H.V." } }, { name name { last "Waugh", initials "R." } } }, affil str "Cell and Molecular Genetics Department, Scottish Crop Research Institute, Invergowrie, Dundee, UK." }, from journal { title { iso-jta "FEBS Lett.", ml-jta "FEBS Lett", issn "0014-5793", name "FEBS letters." }, imp { date std { year 1994, month 10, day 31 }, volume "354", issue "1", pages "123-127", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1994, month 10, day 31 } }, { pubstatus medline, date std { year 1994, month 10, day 31, hour 0, minute 1 } } } } }, ids { pubmed 7957893 } }, muid 95046297, pmid 7957893 } } }, inst { repr raw, mol aa, length 322, seq-data iupacaa "MYQSKLAGTATSYDRHLFLCYKSHETCPARLEASDSDLLPKSFSAALKAR KDDIKIKTLLTICEVRDDMEVSEGDILIFPEMIKYRDLKESDVDAFVDDVLVNGNPWSSGLQESLSGSYVFVCAHNLR DRRCGVCGPILIEEFSKLIESKGLKDKVRVAACSHIGGHKYAGNVIIFSSGKDGDIVGHWYGYVTPSDVPALLDEHIG EGKVIERLWRGQMGQYEKVTDKVDEQKVPEVTNEEKKPLENGSQESSVTSFSCCQGAAGVSCCRDASAEQEENKKGQG TVSNWFGKWEQREILARVGVVGAVAVVAVAYGFYKKSR" }, annot { { data ftable { { id gibb 354877, data prot { name { "Clostridium pasteurianum ferredoxin homolog" }, desc "sucrolytic enzyme/ferredoxin homolog" }, location int { from 0, to 321, strand plus, id gi 707001 } } } }, { data ftable { { id gibb 354872, data cdregion { frame one }, product whole gi 707001, location int { from 135, to 1103, strand plus, id gi 707000 }, xref { { id gibb 354873, data gene { desc "sucrolytic enzyme/ferredoxin homolog" } } } } } } } }, seq { id { swissprot { name "PDIA6_MEDSA", accession "P38661" }, gi 729442 }, descr { title "Probable protein disulfide-isomerase A6 precursor (P5)", source { org { taxname "Medicago sativa", common "alfalfa", db { { db "taxon", tag id 3879 } } } } }, inst { repr raw, mol aa, length 364, seq-data ncbistdaa '0C0A0C050C080F0914111009010B011106010601090B0613 1113110104041313130B1205050D06050A05130708040A07010B13050616010E14030708030A0A 0B010E0516050A0B0E0D11060A0A010A11130B09010A1304030405080A111303110A1607131107 160E12090F14060E0A07110B050E0A0A0605070E10120105110B010506130D12050707120D130A 090112010E11081313130B120E0512060D0513130B0407120A04130B13050616010E1403070803 0A110B010E0916050A13010113060A11050404131309010D0B0401040A1610040B01050A160413 1107060E120B0A06060E0A070D0A010705041607070710040B040406130106090D050A11071211 1004010A070F0B1211050107091305040B04050B130A05061301010D0405050A0A011306011009 050505130A0A0B05071101111016070A09160B0A13110A0A160B050A07110416010A0D05090F10 0B05100B0B050A1109110E010A0104050B120B0A0A0D090B11121601'H } }, seq { id { swissprot { name "GST1_YEAST", accession "P40582" }, gi 731924 }, descr { title "Glutathione S-transferase I (GST-I)", source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } } } } }, inst { repr raw, mol aa, length 234, seq-data ncbistdaa '0C110B0E09090A1308140B040811100106100B0B140B0B04 080B0D0B05160509130E160A1004010D0610010E0E050B0A0A09080E0B0710110E0B0B05130F04 100512070A0A0A090B010511070609060F16130B0F080604081108130B0C11050401040901040F 090D16160B0616130507110B0F0E0E0B0C090506090B110A130A0411070C0E060E0911160B0110 0A1301040A09110F011611110705130A0D0F0604061305070509110A0D0D07160B1304070A0B11 070104090B0C11060E0B0F0C010605100A0601010E0504160E0109110A140B0A12091211050511 160101110A050A0110010B07110D06'H } }, seq { id { ddbj { accession "BAA17828", version 1 }, gi 1652910 }, descr { title "sll1159 [Synechocystis sp. PCC 6803]", source { org { taxname "Synechocystis sp. PCC 6803", common "Synechocystis sp. PCC 6803", db { { db "taxon", tag id 1148 } } } } }, inst { repr raw, mol aa, length 218, seq-data ncbistdaa '0C0D0B0F09050B160A060F0F05110B0A1011110E05100101 0906110406090F070B11050506100D10100B0B1009070406010E0406120B0A0D120A0705120909 0B11050F0B0A12070E090B0B0A060610071614030E1603070B050B1001160F0A13130D0A091001 0B070712090B0109110E0F120B1301110F0A1209041008040B1216040B0B11041107060F12010F 0416070B130612130E0401130A0F09160B0F11070313090E05080D07120505140B0B0E130E0112 061309041010070809010B0116010D13040610131016050E0504010901090B0B110B0613070D'H } }, seq { id { swissprot { name "DIPZ_MYCTU", accession "Q10801" }, gi 1731272 }, descr { title "DipZ protein", source { org { taxname "Mycobacterium tuberculosis", common "Mycobacterium tuberculosis", db { { db "taxon", tag id 1773 } } } } }, inst { repr raw, mol aa, length 695, seq-data ncbistdaa '0C13051110100101010101110116011110030709010E0112 110F10110B01120E0E120911130E11070507100310030813011007010710040E1010100B101010 10140307100307160811080B120707050604130D100B030F0F101110051011030F0B1301130E01 040E100E0A100F10091204130B120B010B1307060B07070B09120709110E03090B0E130B0E1309 06061107010F11130401010F13010A0E05070113011310100A10010B1101120B100E1610130907 070B130B1106070C13120B0B0711010B0B11130B080B0E0F040109101401010B13010B13010907 01070B09060E1006050F0B0B050A0E061110090E0F0A0F09131210110D0706070B070B010B0713 0B16130E0301070E090B010109131301070112011209070B071213130B12011206010B0701010B 0E0B0B0606010B01070F1009010510130701061010100F1005091009011207111312090B0B0113 010B1306040B0E01010B0F1001090E04161201110B0F0F0F0911120712050910050F0B0D0B0707 09130D010F0D010F0B110D0311040701010F0B0511030712010E040B0A07091207140B0D120E07 0D0A0E09040B0A110B10070A13130B0904061401161103090D030F1001090E0813130714160F01 160A0411070B011309071308120E05160106050A130E070D13010A0701010D0B070911160E0901 0B040D0D16011214120D16100D1016140E0105160B090401120712131008090A0607050704160D 131205120B13100F0B0B0D04010A0E07130A0B0E0F0E11111212120E040B120E1001010B120E05 1216060713070A13130D160707070701160405071101130604160E0E110B01010D1106010B1007 1014010B04160F0701121104070D040101090A0B0D1608010A04131609131307071207120B1213 131004070A0E01120B0E0911070E0E1212080F1313010716100B011105120B0513100E110A070B 0F13061106121607'H } }, seq { id { ddbj { accession "BAA20499", version 1 }, gi 2208861 }, descr { title "27kDa outer membrane protein [Coxiella burnetii]", source { org { taxname "Coxiella burnetii", common "Coxiella burnetii", db { { db "taxon", tag id 777 } } } } }, inst { repr raw, mol aa, length 252, seq-data ncbistdaa '0C0A0D100B12010B060B0107120B12010713010901010E11 0F111106110E0F0F130A04090F1109130808160B130D100E05130B130501110F010B0F0A0A1205 010F0F050508010F0F01090A050D010A0A0B060D040E01110E1301070D0E08070D13120B130506 0604160F030708030A010C0D1113090F0109010A0F0D0A0D0B101313060A050B0E090607070F11 0F1601010A13110B0101010A0F070A161601060804010B0B111304070F0B11050F09120B0F1201 050A13070B0D13010F0B0A0A040C040D0E01090F0A0F0B10040D060F0B010F110B0F0B0107120E 12061309070D0A010B120A060706090E070112110F0F0D0B0F0A0509041013050A'H } }, seq { id { swissprot { name "MAUD_METME", accession "Q50232" }, gi 2497800 }, descr { title "Methylamine utilization protein mauD", source { org { taxname "Methylophilus methylotrophus", common "Methylophilus methylotrophus", db { { db "taxon", tag id 17 } } } } }, inst { repr raw, mol aa, length 211, seq-data ncbistdaa '0C121107090B0901110D130B0B140701060B010B01010B0C 0B071309100F09070B0B08051011010E0B07010C0C090408070E0413070510110E09060D130D12 060407050E130B1307101109120E07100E110B0B0C0612070E11030E09030F0A0B0B0E09091011 130101090505120413090B09110407120F010508100F060B0A04080E0B0407050B161313110105 09070C10160F13110A130E1607130B0B040F04070A090B010A070B030D121005081305110B0605 12091005070811120B0F0D160B0A04050D12010E0A060A0F1312010D0A1308'H } }, seq { id { swissprot { name "MPD1_YEAST", accession "Q12404" }, gi 2501204 }, descr { title "Protein disulfide-isomerase MPD1 precursor", source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } } } } }, inst { repr raw, mol aa, length 318, seq-data ncbistdaa '0C0B060B0D09090A0B0B0B070B06090C0D05130A010F0D06 160411040E080911050B120E0A1106040A0109080D120D1612110B13050616010E14030708030A 0A0B11111206100A01010A100B040713130F130101130D03040B0D0A0D0A010B03010A1604130D 07060E120B0C1306100E0E0A09040B110A0E09040D010A0A1106110108010D0513161107011012 0B010E09130406110B111009101116130A0A0613100904120B07110B0B100A110E0A0B1113130B 06110A0F040A09110E13160A1109010B04140B070A060406161109110D0A0A0B0A0F0B12040C0D 0E1216050A120E0509060A160B0F0A13090E050F100F11040A110A0B1313060401040A040A0614 051605070D11090D0A0D0409110A060B100412061109120E0D05070E061110101105160901160B 0A12070A0A0E090A0A0D08111111070D0A0804050B'H } }, seq { id { swissprot { name "PDIA6_HUMAN", accession "Q15084" }, gi 2501205 }, descr { title "Protein disulfide-isomerase A6 precursor (Protein disulfide isomerase P5) (Thioredoxin domain containing protein 7).", sp { class standard, extra-acc { "Q99778" }, seqref { gi 1136742, gi 1136743, gi 12654930, gi 12654931, gi 1710247, gi 1710248, gi 2118334 }, dbref { { db "HSSP", tag str "P07237" }, { db "OGP", tag str "Q15084" }, { db "Ensembl", tag str "ENSG00000143870" }, { db "Genew", tag str "HGNC:30168" }, { db "H-InvDB", tag str "HIX0001822" }, { db "GO", tag str "GO:0003756" }, { db "GO", tag str "GO:0006457" }, { db "InterPro", tag str "IPR005788" }, { db "InterPro", tag str "IPR000886" }, { db "InterPro", tag str "IPR006662" }, { db "InterPro", tag str "IPR006663" }, { db "Pfam", tag str "PF00085" }, { db "PRINTS", tag str "PR00421" }, { db "TIGRFAMs", tag str "TIGR01126" }, { db "PROSITE", tag str "PS00014" }, { db "PROSITE", tag str "PS00194" } }, keywords { "Direct protein sequencing", "Endoplasmic reticulum", "Isomerase", "Polymorphism", "Redox-active center", "Repeat", "Signal" }, created std { year 1997, month 11, day 1 }, sequpd std { year 1997, month 11, day 1 }, annotupd std { year 2005, month 5, day 1 } }, comment "[CATALYTIC ACTIVITY] Catalyzes the rearrangement of -S-S- bonds in proteins.", comment "[SUBCELLULAR LOCATION] Endoplasmic reticulum lumen (By similarity).", comment "[SIMILARITY] Belongs to the protein disulfide isomerase family.", comment "[SIMILARITY] Contains 2 thioredoxin domains.", create-date std { year 1997, month 11, day 1 }, update-date std { year 2005, month 5, day 1 }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } }, molinfo { biomol peptide, completeness complete }, pub { pub { gen { serial-number 1 }, pmid 7590364, article { title { name "Cloning and sequencing of the cDNA encoding human P5." }, authors { names std { { name name { last "Hayano", initials "T." } }, { name name { last "Kikuchi", initials "M." } } }, affil str "Protein Engineering Research Institute, Osaka, Japan." }, from journal { title { iso-jta "Gene", ml-jta "Gene", issn "0378-1119", name "Gene." }, imp { date std { year 1995, month 10, day 27 }, volume "164", issue "2", pages "377-378", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1995, month 10, day 27 } }, { pubstatus medline, date std { year 1995, month 10, day 27, hour 0, minute 1 } } } } }, ids { pubmed 7590364, pii "037811199500474K" } } }, comment "NUCLEOTIDE SEQUENCE [MRNA].~TISSUE=Placenta" }, pub { pub { gen { serial-number 2 }, pmid 12477932, article { title { name "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." }, authors { names std { { name name { last "Strausberg", initials "R.L." } }, { name name { last "Feingold", initials "E.A." } }, { name name { last "Grouse", initials "L.H." } }, { name name { last "Derge", initials "J.G." } }, { name name { last "Klausner", initials "R.D." } }, { name name { last "Collins", initials "F.S." } }, { name name { last "Wagner", initials "L." } }, { name name { last "Shenmen", initials "C.M." } }, { name name { last "Schuler", initials "G.D." } }, { name name { last "Altschul", initials "S.F." } }, { name name { last "Zeeberg", initials "B." } }, { name name { last "Buetow", initials "K.H." } }, { name name { last "Schaefer", initials "C.F." } }, { name name { last "Bhat", initials "N.K." } }, { name name { last "Hopkins", initials "R.F." } }, { name name { last "Jordan", initials "H." } }, { name name { last "Moore", initials "T." } }, { name name { last "Max", initials "S.I." } }, { name name { last "Wang", initials "J." } }, { name name { last "Hsieh", initials "F." } }, { name name { last "Diatchenko", initials "L." } }, { name name { last "Marusina", initials "K." } }, { name name { last "Farmer", initials "A.A." } }, { name name { last "Rubin", initials "G.M." } }, { name name { last "Hong", initials "L." } }, { name name { last "Stapleton", initials "M." } }, { name name { last "Soares", initials "M.B." } }, { name name { last "Bonaldo", initials "M.F." } }, { name name { last "Casavant", initials "T.L." } }, { name name { last "Scheetz", initials "T.E." } }, { name name { last "Brownstein", initials "M.J." } }, { name name { last "Usdin", initials "T.B." } }, { name name { last "Toshiyuki", initials "S." } }, { name name { last "Carninci", initials "P." } }, { name name { last "Prange", initials "C." } }, { name name { last "Raha", initials "S.S." } }, { name name { last "Loquellano", initials "N.A." } }, { name name { last "Peters", initials "G.J." } }, { name name { last "Abramson", initials "R.D." } }, { name name { last "Mullahy", initials "S.J." } }, { name name { last "Bosak", initials "S.A." } }, { name name { last "McEwan", initials "P.J." } }, { name name { last "McKernan", initials "K.J." } }, { name name { last "Malek", initials "J.A." } }, { name name { last "Gunaratne", initials "P.H." } }, { name name { last "Richards", initials "S." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Hale", initials "S." } }, { name name { last "Garcia", initials "A.M." } }, { name name { last "Gay", initials "L.J." } }, { name name { last "Hulyk", initials "S.W." } }, { name name { last "Villalon", initials "D.K." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Sodergren", initials "E.J." } }, { name name { last "Lu", initials "X." } }, { name name { last "Gibbs", initials "R.A." } }, { name name { last "Fahey", initials "J." } }, { name name { last "Helton", initials "E." } }, { name name { last "Ketteman", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Rodrigues", initials "S." } }, { name name { last "Sanchez", initials "A." } }, { name name { last "Whiting", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Young", initials "A.C." } }, { name name { last "Shevchenko", initials "Y." } }, { name name { last "Bouffard", initials "G.G." } }, { name name { last "Blakesley", initials "R.W." } }, { name name { last "Touchman", initials "J.W." } }, { name name { last "Green", initials "E.D." } }, { name name { last "Dickson", initials "M.C." } }, { name name { last "Rodriguez", initials "A.C." } }, { name name { last "Grimwood", initials "J." } }, { name name { last "Schmutz", initials "J." } }, { name name { last "Myers", initials "R.M." } }, { name name { last "Butterfield", initials "Y.S." } }, { name name { last "Krzywinski", initials "M.I." } }, { name name { last "Skalska", initials "U." } }, { name name { last "Smailus", initials "D.E." } }, { name name { last "Schnerch", initials "A." } }, { name name { last "Schein", initials "J.E." } }, { name name { last "Jones", initials "S.J." } }, { name name { last "Marra", initials "M.A." } }, { name consortium "Mammalian Gene Collection Program Team" } }, affil str "National Cancer Institute, Bethessda, MD 20892-2580, USA. rls@nih.gov" }, from journal { title { iso-jta "Proc. Natl. Acad. Sci. U.S.A.", ml-jta "Proc Natl Acad Sci U S A", issn "0027-8424", name "Proceedings of the National Academy of Sciences of the United States of America." }, imp { date std { year 2002, month 12, day 24 }, volume "99", issue "26", pages "16899-16903", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2002, month 12, day 13, hour 4, minute 0 } }, { pubstatus medline, date std { year 2003, month 1, day 22, hour 4, minute 0 } }, { pubstatus aheadofprint, date std { year 2002, month 12, day 11 } } } } }, ids { pubmed 12477932, doi "10.1073/pnas.242603899", pii "242603899" } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].~TISSUE=Placenta" }, pub { pub { gen { serial-number 3 }, pmid 9110174, article { title { name "Large-scale concatenation cDNA sequencing." }, authors { names std { { name name { last "Yu", initials "W." } }, { name name { last "Andersson", initials "B." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Ding", initials "Y." } }, { name name { last "Liu", initials "W." } }, { name name { last "Ricafrente", initials "J.Y." } }, { name name { last "Wentland", initials "M.A." } }, { name name { last "Lennon", initials "G." } }, { name name { last "Gibbs", initials "R.A." } } } }, from journal { title { iso-jta "Genome Res.", ml-jta "Genome Res", issn "1088-9051", name "Genome research." }, imp { date std { year 1997, month 4 }, volume "7", issue "4", pages "353-358", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1997, month 4, day 1 } }, { pubstatus medline, date std { year 1997, month 4, day 1, hour 0, minute 1 } } } } }, ids { pubmed 9110174 } } }, comment "NUCLEOTIDE SEQUENCE OF 20-440, AND VARIANT ARG-214.~TISSUE=Brain" }, pub { pub { gen { serial-number 4 }, gen { cit "Unpublished observations (OCT-2004).", authors { names std { { name name { last "Bienvenut", initials "W.V." } } } } } }, comment "PROTEIN SEQUENCE OF 103-138; 195-212; 217-231; 242-289; 314-328 AND 374-386.~TISSUE=B-cell lymphoma" } }, inst { repr raw, mol aa, length 440, seq-data ncbieaa "MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEF YAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAAL SALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASE VKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINE DIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAI NARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSDVELDDLGKDEL", hist { replaces { date std { year 2005, month 3, day 15 }, ids { gi 2118334 } } } }, annot { { data ftable { { data region "Signal", comment "Potential.", location int { from 0, to 18, id gi 2501205 }, exp-ev not-experimental }, { data region "Mature chain", comment "Protein disulfide-isomerase A6.", location int { from 19, to 439, id gi 2501205 }, exp-ev experimental }, { data bond disulfide, comment "Redox-active (By similarity).", location bond { a { point 54, id gi 2501205 }, b { point 57, id gi 2501205 } }, exp-ev not-experimental }, { data bond disulfide, comment "Redox-active (By similarity).", location bond { a { point 189, id gi 2501205 }, b { point 192, id gi 2501205 } }, exp-ev not-experimental }, { data region "Domain", comment "Asp/Glu-rich (acidic).", location int { from 421, to 433, id gi 2501205 }, exp-ev experimental }, { data site other, comment "Prevent secretion from ER (Potential).", location int { from 436, to 439, id gi 2501205 }, exp-ev not-experimental }, { data region "Variant", comment "K -> R (in dbSNP:4807). /FTId=VAR_022152.", location pnt { point 213, id gi 2501205 }, exp-ev experimental }, { data gene { locus "PDIA6", syn { "TXNDC7;" } }, location int { from 0, to 439, id gi 2501205 } }, { data prot { name { "Protein disulfide-isomerase A6 precursor" }, ec { "5.3.4.1" } }, location int { from 0, to 439, id gi 2501205 } } } } } }, seq { id { swissprot { name "PDIA1_HUMAN", accession "P07237" }, gi 2507460 }, descr { title "Protein disulfide-isomerase precursor (PDI) (Prolyl 4-hydroxylase beta subunit) (Cellular thyroid hormone binding protein) (p55)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 508, seq-data ncbistdaa '0C0B1010010B0B030B011301010B13100104010E05050504 08130B130B100A110D060105010B0101080A160B0B13050616010E14030708030A010B010E0516 010A0101070A0B0A010507110509100B010A13040112050511040B010F0F1607131007160E1209 0A0606100D07041201110E0A0516120107100501040409130D140B0A0A1012070E010112120B0E 040701010105110B1305111105130113090706060A041305110411010A0F060B0F010105010904 04090E06070912110D11041306110A160F0B040A040713130B060A0A06040507100D0D06050705 13120A050D0B0B0406090A080D0F0B0E0B1309050612050F12010E0A0906070705090A1208090B 0B060B0E0A111311041604070A0B110D060A1201010511060A070A090B06090609041104081204 0D0F10090B050606070B0A0A0505030E0113100B09120B0505050C120A160A0E051105050B1201 051009120506030810060B05070A090A0E080B0C110F050B0E050414040A0F0E130A130B13070A 0D06050413010604050A0A0D130613050616010E14030708030A0F0B010E0914040A0B07051216 0A0408050D091309010A0C041112010D05130501130A130811060E120B0A06060E011101041012 130904160D070510120B0407060A0A060B051107070F04070107040404040B05040B0505010505 0E040C05050404040F0A01130A04050B'H } }, seq { id { embl { accession "CAA71103", version 1 }, gi 2582822 }, descr { title "CDSP32 protein (Chloroplast Drought-induced Stress Protein of 32kDa) [Solanum tuberosum]", molinfo { biomol peptide }, comment "Related sequence, EST H76185", pub { pub { sub { authors { names std { { name name { last "Rey", initials "P.J." } } }, affil str "P.J. Rey, CEA-Direction des Sciences du Vivant, Lab. d'Ecophysiologie de la Photosynth., DEVM - Bat. 161, CEA- Cadarache, 13108 Saint-Paul-Les-Durance, FRANCE" }, medium other, date std { year 1997, month 10, day 29 } } } }, pub { pub { gen { cit "Unpublished", authors { names std { { name name { last "Rey", initials "P." } }, { name name { last "Pruvot", initials "G." } }, { name name { last "Becuwe", initials "N." } }, { name name { last "Eymery", initials "F." } }, { name name { last "Rumeau", initials "D." } }, { name name { last "Peltier", initials "G." } } } }, title "A novel thioredoxin-like protein located in the chloroplast is induced by water deficit in Solanum tuberosum L. plants" } }, reftype no-target }, pub { pub { sub { authors { names std { { name name { last "Rey", initials "P.J." } } }, affil str "P.J. Rey, CEA-Direction des Sciences du Vivant, Lab. d'Ecophysiologie de la Photosynth., DEVM - Bat. 161, CEA- Cadarache, 13108 Saint-Paul-Les-Durance, FRANCE" }, medium other, date std { year 1996, month 12, day 10 } } }, comment "Revised by [3]", reftype no-target }, create-date std { year 1997, month 3, day 31 }, update-date std { year 2005, month 4, day 18 }, source { org { taxname "Solanum tuberosum", common "potato", db { { db "taxon", tag id 4113 } }, orgname { name binomial { genus "Solanum", species "tuberosum" }, mod { { subtype cultivar, subname "Haig" } }, lineage "Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicotyledons; asterids; lamiids; Solanales; Solanaceae; Solanum", gcode 1, mgcode 1, div "PLN" } } } }, inst { repr raw, mol aa, length 296, seq-data ncbieaa "MATLTNFLLKPSPNLASITKISPSLYSNFPFEKSKQSIFKNLKTNKPLLI TKATAAPDVEKKVAKSERVQKVNSMEELDEALKKAKNRLVVVEFAGKDSERSKNIYPFMVNLSKTCNDVDFLLVIGDE TEKTKALCRREKIDKVPHFNFYKSMEKIHEEEGIGPDLLAGDVLYYGDSHSEVVQLHSREDVEKVIQDHKIDKKLIVL DVGLKHCGPCVKVYPTVIKLSKQMADTVVFARMNGDENDSCMQFLKDMDVIEVPTFLFIRDGEICGRYVGSGKGELIG EILRYQGVRVTY", hist { replaces { date std { year 1997, month 11, day 2 }, ids { gi 1915958 } } } }, annot { { data ftable { { data prot { name { "CDSP32 protein (Chloroplast Drought-induced Stress Protein of 32kDa)" } }, location whole gi 2582822 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 2582822, location int { from 57, to 947, id gi 2582821 }, dbxref { { db "GOA", tag str "O04002" }, { db "InterPro", tag str "IPR006662" }, { db "UniProt/TrEMBL", tag str "O04002" } } } } } } }, seq { id { genbank { accession "AAC18100", version 1 }, gi 3170570 }, descr { title "FrnE [Streptomyces roseofulvus]", source { org { taxname "Streptomyces roseofulvus", common "Streptomyces roseofulvus", db { { db "taxon", tag id 33902 } } } } }, inst { repr raw, mol aa, length 216, seq-data ncbistdaa '0C0D0509121305091412041313030E14031609070A101006 0510010B01010604010A05041310130814101106050B040E01010B101312040512090E05100C0B 10100F07090E0E050F0101050B0B01071311010F01050105070B0516080B041001100E030D1206 040108100B01080801071210070B010512060F05100B0C030116120105071311130704080E120B 0B010B01050501070B04010101010105130B0107040108010504131001040504100101100B0713 0707130E010613090707101411131107010F0E01050B0B12070B0B051001101201010101'H } }, seq { id { embl { accession "CAA11233", version 1 }, gi 3724143 }, descr { title "NAD-dependent formate dehydrogenase gamma subunit [Cupriavidus necator]", molinfo { biomol peptide }, pub { pub { sub { authors { names std { { name name { last "Bowien", initials "B." } } }, affil str "Bowien B., Institut fuer Mikrobiologie und Genetik, Georg-August-Universitaet Goettingen, Grisebachstr. 8, D-37077 Goettingen, GERMANY" }, medium other, date std { year 2000, month 4, day 28 } } } }, pub { pub { sub { authors { names std { { name name { last "Bowien", initials "B." } } }, affil str "Bowien B., Institut fuer Mikrobiologie und Genetik, Georg-August-Universitaet Goettingen, Grisebachstr. 8, D-37077 Goettingen, GERMANY" }, medium other, date std { year 1998, month 1, day 22 } } }, comment "revised by [3]", reftype no-target }, pub { pub { pmid 9756865, article { title { name "Structural analysis of the fds operon encoding the NAD+-linked formate dehydrogenase of Ralstonia eutropha." }, authors { names std { { name name { last "Oh", initials "J.I." } }, { name name { last "Bowien", initials "B." } } }, affil str "Institut fur Mikrobiologie und Genetik, Georg-August-Universitat Gottingen, Grisebachstrasse 8, D-37077 Gottingen, Germany." }, from journal { title { iso-jta "J. Biol. Chem.", ml-jta "J Biol Chem", issn "0021-9258", name "The Journal of biological chemistry." }, imp { date std { year 1998, month 10, day 9 }, volume "273", issue "41", pages "26349-26360", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1998, month 10, day 3 } }, { pubstatus medline, date std { year 1998, month 10, day 3, hour 0, minute 1 } } } } }, ids { pubmed 9756865 } } }, reftype no-target }, create-date std { year 1998, month 10, day 7 }, update-date std { year 2005, month 4, day 15 }, source { org { taxname "Cupriavidus necator", db { { db "taxon", tag id 106590 } }, orgname { name binomial { genus "Cupriavidus", species "necator" }, mod { { subtype strain, subname "H16" }, { subtype gb-synonym, subname "Ralstonia eutropha" } }, lineage "Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Cupriavidus", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 176, seq-data ncbieaa "MPEISPHAPASADATRIAAIVAARQDIPGALLPILHEIQDTQGYIPDAAV PVIARALNLSRADVHGVITFYHHFRQQPAGRHVVQVCRAEACQSVGAEALAEHAQRALGCGFHETTADGQVTLEPVYC LGQCACGPAVMVGEQLHGYVDARRFDALVRSLRESSAEKTTEAAEAQA" }, annot { { data ftable { { data prot { name { "NAD-dependent formate dehydrogenase gamma subunit" }, ec { "1.2.1.2" } }, location whole gi 3724143 } } }, { data ftable { { data cdregion { frame one, code { id 11 } }, product whole gi 3724143, location int { from 150, to 680, id gi 7672210 }, dbxref { { db "GOA", tag str "O87813" }, { db "InterPro", tag str "IPR002023" }, { db "UniProt/TrEMBL", tag str "O87813" } } } } } } }, seq { id { embl { accession "CAA11234", version 1 }, gi 3724144 }, descr { title "NAD-dependent formate dehydrogenase beta subunit [Cupriavidus necator]", molinfo { biomol peptide }, pub { pub { sub { authors { names std { { name name { last "Bowien", initials "B." } } }, affil str "Bowien B., Institut fuer Mikrobiologie und Genetik, Georg-August-Universitaet Goettingen, Grisebachstr. 8, D-37077 Goettingen, GERMANY" }, medium other, date std { year 2000, month 4, day 28 } } } }, pub { pub { sub { authors { names std { { name name { last "Bowien", initials "B." } } }, affil str "Bowien B., Institut fuer Mikrobiologie und Genetik, Georg-August-Universitaet Goettingen, Grisebachstr. 8, D-37077 Goettingen, GERMANY" }, medium other, date std { year 1998, month 1, day 22 } } }, comment "revised by [3]", reftype no-target }, pub { pub { pmid 9756865, article { title { name "Structural analysis of the fds operon encoding the NAD+-linked formate dehydrogenase of Ralstonia eutropha." }, authors { names std { { name name { last "Oh", initials "J.I." } }, { name name { last "Bowien", initials "B." } } }, affil str "Institut fur Mikrobiologie und Genetik, Georg-August-Universitat Gottingen, Grisebachstrasse 8, D-37077 Gottingen, Germany." }, from journal { title { iso-jta "J. Biol. Chem.", ml-jta "J Biol Chem", issn "0021-9258", name "The Journal of biological chemistry." }, imp { date std { year 1998, month 10, day 9 }, volume "273", issue "41", pages "26349-26360", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1998, month 10, day 3 } }, { pubstatus medline, date std { year 1998, month 10, day 3, hour 0, minute 1 } } } } }, ids { pubmed 9756865 } } }, reftype no-target }, create-date std { year 1998, month 10, day 7 }, update-date std { year 2005, month 4, day 15 }, source { org { taxname "Cupriavidus necator", db { { db "taxon", tag id 106590 } }, orgname { name binomial { genus "Cupriavidus", species "necator" }, mod { { subtype strain, subname "H16" }, { subtype gb-synonym, subname "Ralstonia eutropha" } }, lineage "Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Cupriavidus", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 520, seq-data ncbieaa "MITITTIFVPRDSTALALGADDVARAIAREAAARNEHVRIVRNGSRGMFW LEPLVEVQTGAGRVAYGPVSAADVPGLFDAGLLQGGEHALSQGVTEEIPFLKQQERLTFARVGITDPLSLDDYRAHEG FAGLERALAMQPAEIVQEVTDSGLRGRGGAAFPTGIKWKTVLGAQSAVKYIVCNADEGDSGTFSDRMVMEDDPFMLIE GMTIAALAVGAEQGYIYCRSEYPHAIAVLESAIGIANAAGWLGDDIRGSGKRFHLEVRKGAGAYVCGEETALLESLEG RRGVVRAKPPLPALQGLFGKPTVINNVISLATVAGESWRAAEYYRDYGMGRSRGTLPFQLAGNIKQGGLVEKAFGVTL RELLVDYGGGTRSGRAIRAVQVGGPLGAYLPESRFDVPLDYEAYAAFGGVVGHGGIVVFDETVDMAKAGPYAMEFCAI ESCGKCTPCRIGSTRGVEVMDRIIAGEQPVKHVALVRDLCDTMLNGSLCAMGGMTPYPVLSALNEFPEDFGLASNPAK AA" }, annot { { data ftable { { data prot { name { "NAD-dependent formate dehydrogenase beta subunit" }, ec { "1.2.1.2" } }, location whole gi 3724144 } } }, { data ftable { { data cdregion { frame one, code { id 11 } }, product whole gi 3724144, location int { from 677, to 2239, id gi 7672210 }, exp-ev experimental, dbxref { { db "GOA", tag str "O87814" }, { db "InterPro", tag str "IPR001949" }, { db "InterPro", tag str "IPR011538" }, { db "UniProt/TrEMBL", tag str "O87814" } } } } } } }, seq { id { other { accession "NP_006399", version 1 }, gi 5453541 }, descr { molinfo { biomol peptide }, title "anterior gradient 2 homolog [Homo sapiens]", create-date std { year 1999, month 7, day 13 }, source { genome genomic, org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } }, subtype { { subtype chromosome, name "7" }, { subtype map, name "7p21.3" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Provisional" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "AF115926.1" }, { label str "gi", data int 17998665 } } } } }, { label str "Related", data fields { { label id 0, data fields { { label str "accession", data str "AF007791.1" }, { label str "gi", data int 3779197 } } }, { label id 0, data fields { { label str "accession", data str "AF038451.1" }, { label str "gi", data int 3779226 } } } } } } }, pub { pub { pmid 9790916, article { title { name "hAG-2, the human homologue of the Xenopus laevis cement gland gene XAG-2, is coexpressed with estrogen receptor in breast cancer cell lines." }, authors { names std { { name name { last "Thompson", initials "D.A." } }, { name name { last "Weigel", initials "R.J." } } }, affil str "Department of Surgery, Stanford University, Stanford, California, 94305-5494, USA." }, from journal { title { iso-jta "Biochem. Biophys. Res. Commun.", issn "0006-291X" }, imp { date std { year 1998, month 10, day 9 }, volume "251", issue "1", pages "111-116", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1998, month 10, day 29 } }, { pubstatus medline, date std { year 1998, month 10, day 29, hour 0, minute 1 } } } } }, ids { pubmed 9790916, pii "S0006291X98994402" } } } }, pub { pub { pmid 10965104, article { title { name "Localization of the human anterior gradient-2 gene (AGR2) to chromosome band 7p21.3 by radiation hybrid mapping and fluorescencein situ hybridisation." }, authors { names std { { name name { last "Petek", initials "E." } }, { name name { last "Windpassinger", initials "C." } }, { name name { last "Egger", initials "H." } }, { name name { last "Kroisel", initials "P.M." } }, { name name { last "Wagner", initials "K." } } }, affil str "Institute of Medical Biology and Human Genetics, University of Graz, Austria. petek@kfunigraz.ac.at" }, from journal { title { iso-jta "Cytogenet. Cell Genet.", issn "0301-0171" }, imp { date std { year 2000 }, volume "89", issue "3-4", pages "141-142", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2000, month 8, day 31, hour 11, minute 0 } }, { pubstatus medline, date std { year 2000, month 9, day 23, hour 11, minute 1 } } } } }, ids { pubmed 10965104, pii "ccg89141" } } } }, pub { pub { pmid 12592373, article { title { name "hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan." }, authors { names std { { name name { last "Fletcher", initials "G.C." } }, { name name { last "Patel", initials "S." } }, { name name { last "Tyson", initials "K." } }, { name name { last "Adam", initials "P.J." } }, { name name { last "Schenker", initials "M." } }, { name name { last "Loader", initials "J.A." } }, { name name { last "Daviet", initials "L." } }, { name name { last "Legrain", initials "P." } }, { name name { last "Parekh", initials "R." } }, { name name { last "Harris", initials "A.L." } }, { name name { last "Terrett", initials "J.A." } } }, affil str "Oxford Glycosciences, Abingdon, Oxon, UK." }, from journal { title { iso-jta "Br. J. Cancer", issn "0007-0920" }, imp { date std { year 2003, month 2, day 24 }, volume "88", issue "4", pages "579-585", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2003, month 2, day 20, hour 4, minute 0 } }, { pubstatus medline, date std { year 2003, month 4, day 5, hour 5, minute 0 } } } } }, ids { pubmed 12592373, doi "10.1038/sj.bjc.6600740", pii "6600740" } } }, comment "GeneRIF: hAG-2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan." }, pub { pub { pmid 12975309, article { title { name "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." }, authors { names std { { name name { last "Clark", initials "H.F." } }, { name name { last "Gurney", initials "A.L." } }, { name name { last "Abaya", initials "E." } }, { name name { last "Baker", initials "K." } }, { name name { last "Baldwin", initials "D." } }, { name name { last "Brush", initials "J." } }, { name name { last "Chen", initials "J." } }, { name name { last "Chow", initials "B." } }, { name name { last "Chui", initials "C." } }, { name name { last "Crowley", initials "C." } }, { name name { last "Currell", initials "B." } }, { name name { last "Deuel", initials "B." } }, { name name { last "Dowd", initials "P." } }, { name name { last "Eaton", initials "D." } }, { name name { last "Foster", initials "J." } }, { name name { last "Grimaldi", initials "C." } }, { name name { last "Gu", initials "Q." } }, { name name { last "Hass", initials "P.E." } }, { name name { last "Heldens", initials "S." } }, { name name { last "Huang", initials "A." } }, { name name { last "Kim", initials "H.S." } }, { name name { last "Klimowski", initials "L." } }, { name name { last "Jin", initials "Y." } }, { name name { last "Johnson", initials "S." } }, { name name { last "Lee", initials "J." } }, { name name { last "Lewis", initials "L." } }, { name name { last "Liao", initials "D." } }, { name name { last "Mark", initials "M." } }, { name name { last "Robbie", initials "E." } }, { name name { last "Sanchez", initials "C." } }, { name name { last "Schoenfeld", initials "J." } }, { name name { last "Seshagiri", initials "S." } }, { name name { last "Simmons", initials "L." } }, { name name { last "Singh", initials "J." } }, { name name { last "Smith", initials "V." } }, { name name { last "Stinson", initials "J." } }, { name name { last "Vagts", initials "A." } }, { name name { last "Vandlen", initials "R." } }, { name name { last "Watanabe", initials "C." } }, { name name { last "Wieand", initials "D." } }, { name name { last "Woods", initials "K." } }, { name name { last "Xie", initials "M.H." } }, { name name { last "Yansura", initials "D." } }, { name name { last "Yi", initials "S." } }, { name name { last "Yu", initials "G." } }, { name name { last "Yuan", initials "J." } }, { name name { last "Zhang", initials "M." } }, { name name { last "Zhang", initials "Z." } }, { name name { last "Goddard", initials "A." } }, { name name { last "Wood", initials "W.I." } }, { name name { last "Godowski", initials "P." } }, { name name { last "Gray", initials "A." } } }, affil str "Departments of Bioinformatics, Molecular Biology and Protein Chemistry, Genentech, Inc, South San Francisco, California 94080, USA. hclark@gene.com" }, from journal { title { iso-jta "Genome Res.", issn "1088-9051" }, imp { date std { year 2003, month 10 }, volume "13", issue "10", pages "2265-2270", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2003, month 9, day 17, hour 5, minute 0 } }, { pubstatus medline, date std { year 2003, month 12, day 9, hour 5, minute 0 } }, { pubstatus aheadofprint, date std { year 2003, month 9, day 15 } } } } }, ids { pubmed 12975309, doi "10.1101/gr.1293003", pii "1293003" } } } }, pub { pub { pmid 12690205, article { title { name "Human chromosome 7: DNA sequence and biology." }, authors { names std { { name name { last "Scherer", initials "S.W." } }, { name name { last "Cheung", initials "J." } }, { name name { last "MacDonald", initials "J.R." } }, { name name { last "Osborne", initials "L.R." } }, { name name { last "Nakabayashi", initials "K." } }, { name name { last "Herbrick", initials "J.A." } }, { name name { last "Carson", initials "A.R." } }, { name name { last "Parker-Katiraee", initials "L." } }, { name name { last "Skaug", initials "J." } }, { name name { last "Khaja", initials "R." } }, { name name { last "Zhang", initials "J." } }, { name name { last "Hudek", initials "A.K." } }, { name name { last "Li", initials "M." } }, { name name { last "Haddad", initials "M." } }, { name name { last "Duggan", initials "G.E." } }, { name name { last "Fernandez", initials "B.A." } }, { name name { last "Kanematsu", initials "E." } }, { name name { last "Gentles", initials "S." } }, { name name { last "Christopoulos", initials "C.C." } }, { name name { last "Choufani", initials "S." } }, { name name { last "Kwasnicka", initials "D." } }, { name name { last "Zheng", initials "X.H." } }, { name name { last "Lai", initials "Z." } }, { name name { last "Nusskern", initials "D." } }, { name name { last "Zhang", initials "Q." } }, { name name { last "Gu", initials "Z." } }, { name name { last "Lu", initials "F." } }, { name name { last "Zeesman", initials "S." } }, { name name { last "Nowaczyk", initials "M.J." } }, { name name { last "Teshima", initials "I." } }, { name name { last "Chitayat", initials "D." } }, { name name { last "Shuman", initials "C." } }, { name name { last "Weksberg", initials "R." } }, { name name { last "Zackai", initials "E.H." } }, { name name { last "Grebe", initials "T.A." } }, { name name { last "Cox", initials "S.R." } }, { name name { last "Kirkpatrick", initials "S.J." } }, { name name { last "Rahman", initials "N." } }, { name name { last "Friedman", initials "J.M." } }, { name name { last "Heng", initials "H.H." } }, { name name { last "Pelicci", initials "P.G." } }, { name name { last "Lo-Coco", initials "F." } }, { name name { last "Belloni", initials "E." } }, { name name { last "Shaffer", initials "L.G." } }, { name name { last "Pober", initials "B." } }, { name name { last "Morton", initials "C.C." } }, { name name { last "Gusella", initials "J.F." } }, { name name { last "Bruns", initials "G.A." } }, { name name { last "Korf", initials "B.R." } }, { name name { last "Quade", initials "B.J." } }, { name name { last "Ligon", initials "A.H." } }, { name name { last "Ferguson", initials "H." } }, { name name { last "Higgins", initials "A.W." } }, { name name { last "Leach", initials "N.T." } }, { name name { last "Herrick", initials "S.R." } }, { name name { last "Lemyre", initials "E." } }, { name name { last "Farra", initials "C.G." } }, { name name { last "Kim", initials "H.G." } }, { name name { last "Summers", initials "A.M." } }, { name name { last "Gripp", initials "K.W." } }, { name name { last "Roberts", initials "W." } }, { name name { last "Szatmari", initials "P." } }, { name name { last "Winsor", initials "E.J." } }, { name name { last "Grzeschik", initials "K.H." } }, { name name { last "Teebi", initials "A." } }, { name name { last "Minassian", initials "B.A." } }, { name name { last "Kere", initials "J." } }, { name name { last "Armengol", initials "L." } }, { name name { last "Pujana", initials "M.A." } }, { name name { last "Estivill", initials "X." } }, { name name { last "Wilson", initials "M.D." } }, { name name { last "Koop", initials "B.F." } }, { name name { last "Tosi", initials "S." } }, { name name { last "Moore", initials "G.E." } }, { name name { last "Boright", initials "A.P." } }, { name name { last "Zlotorynski", initials "E." } }, { name name { last "Kerem", initials "B." } }, { name name { last "Kroisel", initials "P.M." } }, { name name { last "Petek", initials "E." } }, { name name { last "Oscier", initials "D.G." } }, { name name { last "Mould", initials "S.J." } }, { name name { last "Dohner", initials "H." } }, { name name { last "Dohner", initials "K." } }, { name name { last "Rommens", initials "J.M." } }, { name name { last "Vincent", initials "J.B." } }, { name name { last "Venter", initials "J.C." } }, { name name { last "Li", initials "P.W." } }, { name name { last "Mural", initials "R.J." } }, { name name { last "Adams", initials "M.D." } }, { name name { last "Tsui", initials "L.C." } } }, affil str "Department of Genetics and Genomic Biology, The Hospital for Sick Children, Toronto, Ontario, Canada, M5G 1X8. steve@genet.sickkids.on.ca" }, from journal { title { iso-jta "Science", issn "1095-9203" }, imp { date std { year 2003, month 5, day 2 }, volume "300", issue "5620", pages "767-772", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2003, month 4, day 12, hour 5, minute 0 } }, { pubstatus medline, date std { year 2003, month 5, day 28, hour 5, minute 0 } }, { pubstatus aheadofprint, date std { year 2003, month 4, day 10 } } } } }, ids { pubmed 12690205, doi "10.1126/science.1083423", pii "1083423" } } } }, update-date std { year 2005, month 4, day 23 } }, inst { repr raw, mol aa, length 175, seq-data ncbieaa "MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGD QLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRI MFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL" }, annot { { data ftable { { data prot { name { "anterior gradient 2 homolog", "anterior gradient 2 homolog (Xenepus laevis)", "anterior gradient 2 (Xenepus laevis) homolog", "secreted cement gland homolog" } }, location whole gi 5453541 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 5453541, location int { from 57, to 584, id gi 20070225 }, ext { type str "GeneOntology", data { } }, dbxref { { db "CCDS", tag str "CCDS5364.1" } } } } } } }, seq { id { genbank { accession "AAD55888", version 1 }, gi 5916091 }, descr { title "hypothetical protein [Wautersia eutropha]", source { org { taxname "Cupriavidus necator", common "Cupriavidus necator", db { { db "taxon", tag id 106590 } } } } }, inst { repr raw, mol aa, length 283, seq-data ncbistdaa '0C07100F110A11010B100F0F0F100E0101010707010E0101 010101010B10050C0F1014090110090308110314101011100B12060B080E101009010B12101011 040C050D0F01120B08161316040E160307140316070B010E0B0911130105051205070B0A131301 080707070C0B01070510010F0C0C1107051410050613100E080501100912010B11070F12060712 0E160F0507120F060D1604130A0B0411010E0E1201010C0B01010514130104010713100C0B0A10 0B0F1201161613050710080901051001050B1308090113050B070B040108010611120116040F01 0B100509070C0806100D120F010B0B04010B07070F07160E120B0109051004070C0B111009080B 07101606070A0E0510061005010B01050B0C010E0E0F0E1301'H } }, seq { id { swissprot { name "PLP1_YEAST", accession "Q04004" }, gi 6136668 }, descr { title "Phosducin-like protein 1", source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } } } } }, inst { repr raw, mol aa, length 230, seq-data ncbistdaa '0C05040A0B04101616120D130B110D01050A040A08121213 041104040A11110705050D0B04050B0B0D050B0410050B0405040805060B110116101105100B0F 0F091104080B0A0F130A0A0D13050404071607100B0F0309040D05010401090F0903120A12120C 1313090806050B051206070A030F160C0D050A0B050D0B010A10160B12121006090A130D130F12 030E060B130D0A0B0D090A130B0E06131307160A0D070B050A131016130706110A0B070D040E0D 0706040910100B050F110B010811071309050412060509100A081111130D120510060111120D08 04101105110411040B0409'H } }, seq { id { genbank { accession "AAF28841", version 1 }, gi 6840947 }, descr { title "PKCq-interacting protein PICOT [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 335, seq-data ncbistdaa '0C0101070101050101130101130505130711010708060505 0B0B100B0A010A110B0B1313080614010E14010E0F03010F0C0D05130C01050B010A050B0E0F13 1106130A0B05010507130E051311050A1605091111130E12060B06060A0D110F0A0904100B0407 0108010E050B120A0A130F10080111110711060B1111010D05080B0A05040B0D0B100B0A0A0B12 0801010E030C0B060C0A07120E0F050E10030706110A0F0C1305090B080A080D090F0611110604 09061104050513100F070B0A01161111140E12160E0F0B16131107050B0907070B0409090A050B 05011105050B041209030E0A010E0A0B0505100B0A130B120D0A0111130C0B060C0A070D0A0F05 010A030706110A0F090B05090B0D11120713051605120604090B0504050513100F070B0A011611 0D140E12160E0F0B16130A07050B1307070B0409130A050B0A050D07050B0B0E090B1007050D'H } }, seq { id { embl { accession "CAB72177", version 1 }, gi 6911877 }, descr { title "putative protein [Arabidopsis thaliana]", source { org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } } } } }, inst { repr raw, mol aa, length 417, seq-data ncbistdaa '0C07111101110A1201111113111101111111110106110E0E 0E120A061111041111110E01130F10010611060E120E0B1308080E0E01100A07041108080B1311 0B121112111607110B0B0B0B040B0407110A0D111111040F0F120B0E1009110911070A0D120E04 0E13110E041113090D1214050B0C04070B04040506050605090E0A0E070A100B0D11040603110A 0E040E0D100D13110B0D0711110B0A0B04051116050913100905050404070414130E0B12160A0E 0A0F0E0B140A080B11050511060B11040B040E1109131111160A0A010B11110A0B0B110D08110D 12100D0E08100E120A110B1103110E11110D0E11090B091105050E0A11131111110F0B0911110E 010A0E100B0E071205040A09130B160612120B100709100A12160504030303131001090B100713 0F1311130405100409110C04110A16100A050B0F11130B070101050A0E13030B0E0F1306091007 1208090707130505090C0F0B0D040707050B01050C0B0A04060E010305100B0712031011030704 011006130E03120D03040711120A130605050F040510060A10030E0A030D050D070B1310031013 03030B'H } }, seq { id { other { accession "NP_057043", version 1 }, gi 7705726 }, descr { title "thioredoxin-related transmembrane protein 2 [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 296, seq-data ncbistdaa '0C01130B010E0B09010B131611130E100B1110140B010F0E 16160B0B11010B0B110101060B0B13100A0B0E0E0B0308070B0E120F100504070D0E0304060414 10051305090B0C060B110109130C0C0A0D101011091213050F0809070D09060C06110A13010D12 090B0606100B0409100C070B0B1609120B030913060B0C12030A0E0E0B160C070E0516090A1606 0D040A12090405050B0510040A101312140913050606010D14110D04030F1106010E091601040B 110B0A160D0312070B0D06070A130413071016120413111210160A131112110E0B120A0F0B0E12 0B090B060F07070A05010C10100E0F09040A0A07100113111412061105050D13091005060D0B0D 050B160F10010A0A0B110A0107040D090E05050F0E130111120E121213110407050D0A0A040A'H } }, seq { id { swissprot { name "SPX_BACSU", accession "O31602" }, gi 11135548 }, descr { title "Regulatory protein spx", source { org { taxname "Bacillus subtilis", common "Bacillus subtilis", db { { db "taxon", tag id 1423 } } } } }, inst { repr raw, mol aa, length 131, seq-data ncbistdaa '0C13120B1612110E1103121103100A011001140B05050805 090E061305100D090611050E0B11090405090A0F090B100C120504071204050909111210110A13 060F0A0B0D130D1305110C0E0B0F040B16100B090D05080E070B0B10100E09090904050A100B0F 1307160D050405091010060B0E100A131011060F0B1005010F100B010D'H } }, seq { id { ddbj { accession "BAB47459", version 1 }, gi 14017877 }, descr { title "KIAA1830 protein [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 486, seq-data ncbistdaa '11010E060E060E07070F0101040E111306090E0B0B08110F 0B0B0F0B111001110C0101140A111412010B100B0301121313130B040C1313030A07061305040B 040511060A050D100D040409140B13040616010E14030708030A0A0B050E09140D0513070B050C 0A110907110E130A13070A0C04011211161111090111050607131007160E12090A0B0B0A07040B 01160D1610070E10120A040409090506010810131107010B09100E0B0E110F0F0C0605080C0F0A 100810130606131613070705110E0B0A050A160904010111050B09131612160606110111050513 130E051613120B0A050C0E01130B13060A04051216061316040516050407040B111114090D1005 10060F0D160B010C0407060B0B16050B070412070A0B13010B01130904050A0D12111305081210 0B0A1109090F05130110041610040B06081004060F0607080C04070D0416090D120B0B0C04050B 12130E121313130B0D12110D0F0F16060B0B04100F090A0D1305040C130F06090D0D090B040712 1305010F07070411090B0F100B0A1009130604010A111209131109060A11110E0B0C0703060B06 070B0E0B07130911090C0316070916120104120407071609050510160513110A11050D050D0F05 0F090505110A050F0F050E111107071113130E12130F050E0A04130B050A0A0A04'H } }, seq { id { other { accession "NP_246037", version 1 }, gi 15602965 }, descr { title "UreX [Pasteurella multocida subsp. multocida str. Pm70]", source { org { taxname "Pasteurella multocida subsp. multocida str. Pm70", common "Pasteurella multocida subsp. multocida str. Pm70", db { { db "taxon", tag id 272843 } } } } }, inst { repr raw, mol aa, length 207, seq-data ncbistdaa '0C0A0B1408110D12110E1613100A130C0113090A08080F0B 05040F09050B0812090F111106040E0D110E080D0F040D0E0B0710130E010B0F0B040D0705140B 160D110813090305160B04080B07010F120F110511080B0B0E100D110F10140A130B0F0B08010B 120407090C050D120B0E09091105100B0B100E050D051414120110080F0F0B1105100D09101106 0A050B0510160B130F060704050B0D0B071209110113030B09041416010B1007050A0B07130D0B 0A0509010E080B130F14010C050C0D040A160E050B0A05120F0E0A'H } }, seq { id { ddbj { accession "BAB68388", version 1 }, gi 15721860 }, descr { title "dynein intermediate chain 3 [Ciona intestinalis]", source { org { taxname "Ciona intestinalis", common "Ciona intestinalis", db { { db "taxon", tag id 7719 } } } } }, inst { repr raw, mol aa, length 653, seq-data ncbistdaa '0C010A100A0513090B0F05120B0D120F0501140513010C0D 11070A0B1613130401080F0A1403070E0312010913070C0B0A10090A0D050B0704040B0B100601 12010F1304130904120B050F1610070A03050E0D060B0616070707050B130101131007030D010E 0B130F0512090F05120B0A0D05080A090B1107050C05100A1306100413161104120E040F050505 050504050505050507071313110A0F091213010B090A0E0413130F0D070F130405090B0F0A0911 0501070905130B01040505100C0B1213050501100406160A0D0A050505051606040F0B09041613 1211070E0310130B130B120A0705110705071313120B1410040909070E0604010113010A05050D 0E04110B100109160712040112110D010B0807111111120505011310050B070606060E04060A0E 0E12161011010A11010111100111071010110A120E110F0A0E100B0F10120B010909100E04010B 0F01080A0411090B0F0A0904050107060A09010C0F0A050C130B1210050F01051106161105080A 0412041606050E0B130A0F0C1203070E130B010B030B01080404011304081410110C0B070E0A13 130104011305050F0E04110B10010F06101305050105130D0C0B0807110411010501010505050B 110A09060813050F120B0113090A0E04010904050A050F090C070A0B0A050107060C0911030F0A 040C0D0B110A050901110509160A110A05071105161604080B0904080C1211070E120B0C0C130B 1101050D0113050A0B1004090C070E12040E0513010A0511080E05110B10010C06010A11090B05 0D010908110E11120D0511010F050A09100913060704010F06041404130D040C0F010505070513 0D05121107050F0E1204050F11070512050A120505040705080507010F11040F0F0F0113110501 0C050A0505'H } }, seq { id { other { accession "NP_345916", version 1 }, gi 15901312 }, descr { title "hypothetical protein SP1462 [Streptococcus pneumoniae TIGR4]", source { org { taxname "Streptococcus pneumoniae TIGR4", common "Streptococcus pneumoniae TIGR4", db { { db "taxon", tag id 170187 } } } } }, inst { repr raw, mol aa, length 118, seq-data ncbistdaa '0C0B05060905160E0A031112030A0A010A0F050B0D0F0B07 1304160A01130809130505120E110F0513090B0D140B0512110706050B0A0F06060D121107090A 1610050B070B0A040A1307110B110D0F050101050B0B011104070C0B0B0A100E090B13050D0712 130A0F090716100A111605050B070B0A'H } }, seq { id { embl { accession "CAD05474", version 1 }, gi 16502979 }, descr { title "hydrogenase-1 operon protein HyaE [Salmonella enterica subsp. enterica serovar Typhi]", molinfo { biomol peptide }, comment "E-mail: parkhill@sanger.ac.uk~Notes:~Details of S. typhi sequencing at the Sanger Centre are available on the World Wide Web.~(URL, http://www.sanger.ac.uk/Projects/S_typhi/)", pub { pub { muid 21534947, article { title { name "Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18." }, authors { names std { { name name { last "Parkhill", initials "J." } }, { name name { last "Dougan", initials "G." } }, { name name { last "James", initials "K.D." } }, { name name { last "Thomson", initials "N.R." } }, { name name { last "Pickard", initials "D." } }, { name name { last "Wain", initials "J." } }, { name name { last "Churcher", initials "C." } }, { name name { last "Mungall", initials "K.L." } }, { name name { last "Bentley", initials "S.D." } }, { name name { last "Holden", initials "M.T.G." } }, { name name { last "Sebaihia", initials "M." } }, { name name { last "Baker", initials "S." } }, { name name { last "Basham", initials "D." } }, { name name { last "Brooks", initials "K." } }, { name name { last "Chillingworth", initials "T." } }, { name name { last "Connerton", initials "P." } }, { name name { last "Cronin", initials "A." } }, { name name { last "Davis", initials "P." } }, { name name { last "Davies", initials "R.M." } }, { name name { last "Dowd", initials "L." } }, { name name { last "White", initials "N." } }, { name name { last "Farrar", initials "J." } }, { name name { last "Feltwell", initials "T." } }, { name name { last "Hamlin", initials "N." } }, { name name { last "Haque", initials "A." } }, { name name { last "Hien", initials "T.T." } }, { name name { last "Holroyd", initials "S." } }, { name name { last "Jagels", initials "K." } }, { name name { last "Krogh", initials "A." } }, { name name { last "Larsen", initials "T.S." } }, { name name { last "Leather", initials "S." } }, { name name { last "Moule", initials "S." } }, { name name { last "O'Gaora", initials "P." } }, { name name { last "Parry", initials "C." } }, { name name { last "Quail", initials "M." } }, { name name { last "Rutherford", initials "K." } }, { name name { last "Simmonds", initials "M." } }, { name name { last "Skelton", initials "J." } }, { name name { last "Stevens", initials "K." } }, { name name { last "Whitehead", initials "S." } }, { name name { last "Barrell", initials "B.G." } } } }, from journal { title { iso-jta "Nature", ml-jta "Nature", issn "0028-0836", name "Nature." }, imp { date std { year 2001, month 10, day 25 }, volume "413", issue "6858", pages "848-852", language "eng" } }, ids { pubmed 11677608, medline 21534947 } }, pmid 11677608 } }, pub { pub { sub { authors { names std { { name name { last "Parkhill", initials "J." } } }, affil str "Submitted on behalf of the Salmonalla sequencing team, Sanger Centre, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SA, UK" }, medium other, date std { year 2001, month 10, day 25 } } } }, create-date std { year 2001, month 10, day 25 }, update-date std { year 2003, month 7, day 4 }, source { org { taxname "Salmonella enterica subsp. enterica serovar Typhi", db { { db "taxon", tag id 90370 } }, orgname { name binomial { genus "Salmonella", species "enterica", subspecies "subsp. enterica" }, mod { { subtype strain, subname "CT18" } }, lineage "Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Salmonella", gcode 11, div "BCT" } } } }, inst { repr raw, mol aa, length 134, seq-data ncbieaa "MANDTPFSALWQRLLTRGWQPVEASTVDDWIKRIGDGVILLSSDPRRTPE VSDNPVMIAELLREFPQFDWQVAVADLEQSEAIGDRFNVRRFPATLVFTDGELRGALSGIHPWAELLTLMRSMVDTPA AQETAQ" }, annot { { data ftable { { data prot { name { "hydrogenase-1 operon protein HyaE" } }, location whole gi 16502979 } } }, { data ftable { { data cdregion { frame one, code { id 11 } }, comment "Orthologue of E. coli hyaE (HYAE_ECOLI); Fasta hit to HYAE_ECOLI (132 aa), 71% identity in 133 aa overlap", product whole gi 16502979, location int { from 4670, to 5074, id gi 16502975 }, dbxref { { db "SPTREMBL", tag str "Q8Z693" } } } } } } }, seq { id { other { accession "NP_491995", version 1 }, gi 17507915 }, descr { title "protein disulfide isomerase (54.9 kD) (pdi-3) [Caenorhabditis elegans]", source { org { taxname "Caenorhabditis elegans", common "nematode", db { { db "taxon", tag id 6239 } } } } }, inst { repr raw, mol aa, length 488, seq-data ncbistdaa '0C0914130F01010B130111060B0106011101070701130B05 161204070D0604040B090F12080409010B130A0616010E14030708030A0A09010E051605100101 0E0A0B01110D040E0E13010B130A1304031212050A121303040A0607130A07060E120B0A090610 0D07130E010F041604070E100401040709130A060C10070F11070E11110A050B0A121301050605 0A0612070704050D131309070606051105110A0B0A0411160B0A13010412051004100611060108 12110D0A0409090A0A01071611040413131306130E0A0A0B080D0A0604120D05060A1604070D16 0412040A090A0D060B1308051213070601070910120F070D0B060F06050F0A0E0913091316160D 130416130A040E0A07110D1614100D10130B0A13010F0D160A100A130F060113110D0A05050611 11050905120D070B0705100A0411040A0E091301090B120D05070A160E0C040F05061113040D0B 0F0F06130405130B01070D01050E160C0A11050E090E04050F0704130A130113070A0D060A050B 090C0401040A04130B09050616010E14030708030A110B010E0A1605050B01050A0B0D0A050413 0909010A0C040112010D04130E0E0C0605131007060E120B06140B0E0A0D010A110D0E090E160D 07071005130A040613110609110A08111204070B0A0706111004070A0A0A0A0A12050B'H } }, seq { id { other { accession "NP_502314", version 1 }, gi 17540154 }, descr { title "quiescin Q6 precursor family member (69.5 kD) (4M971) [Caenorhabditis elegans]", source { org { taxname "Caenorhabditis elegans", common "nematode", db { { db "taxon", tag id 6239 } } } } }, inst { repr raw, mol aa, length 601, seq-data ncbistdaa '0C10110E0807121311121212120911030B0B060901130B0E 1311090501130F1112060D16130E09070F0D0E120B16120E0706050E090C080B040F0C12060D04 12130611041001060B1305061601041403070803100106010E1606100F06010D0C13100414160E 131312130113090D03010411060D0F01010310050D07131216060E0C0C0A160601101201121201 120F070A0B0605120E081101050F091004010B0B101213110D05160C060D10160E04140E0D0B07 08090113041110121216070F0B140407130E0F0A010D160C01090B0605051604071307010F0613 0C040B0911101108090B07011010010B110D110E0B130F0C0B0D09100D060E1213010B06101004 080F0F010B160C0F1016120D0F12130A040904040109120D040C050F07071010010E090B121212 0B010E13121212120D120E0B0904030811080E05100310040C161613110512040C0B0A010C100C 010B0B0405131210130E0701091007040D06120D0B0805060C120B0B110D08060E130B11060F0D 040910100C10010A1012121113090B100D11051001100B130612080C1005060B0507100A110907 1113111104051610100F060511130510131601110E060E130D1112140F08030A0711110E0C1610 07161203070B1412120608010B1213081216090412090A040416130D0E0C0A0E0B1112090F0714 130A1116060703050803100D08060C080C1212120B060E0B0D0510101310080E08040C0C12160B 141001080D09130D0D100B080704111205040E0F06120A0C0F060E010E060B030E120308110707 0F061110100F09100D060B0B1016160711090A0E080D100B01040F100B0106'H } }, seq { id { swissprot { name "YBBN_ECOLI", accession "P77395" }, gi 18271743 }, descr { title "Protein ybbN", source { org { taxname "Escherichia coli", common "Escherichia coli", db { { db "taxon", tag id 562 } } } } }, inst { repr raw, mol aa, length 284, seq-data ncbistdaa '0C1113050D09130D090D05110D0B0F0F130B050F110C1212 0E130B06160614110510110F08030B0F0B120E090B05110B01010F160D070F06090B010A0B0403 0401050F0C0901010F06070B1001090E1213160B060F0D070F0E130407060F070E0F0E05050109 10010B0B040A130B0E100505050B0A010F0F010C0F0B0C0F05110D161204010B0E0B0B0A040114 0F0B110D0F0D070509070B0B0B0105120B09010B0D10110504010501130B0A12090E0B0F040F04 1210160F070B13010F09050B0B0A0F010104120E05090F0F0B0F0F0F1301050D0E050401010B01 120F0B010B0F0B080F1307100D0505010B050B0B0607080B100A040B12010104070F12100A1206 0F05090B01010B07120704010B01110A1610100F0B16010B0B16'H } }, seq { id { other { accession "NP_567349", version 1 }, gi 18413285 }, descr { molinfo { biomol peptide, tech concept-trans }, title "expressed protein [Arabidopsis thaliana]", user { type str "RefGeneTracking", data { { label str "Assembly", data fields { { label id 0, data fields { { label str "name", data str "cds.At4g10000.1" } } } } }, { label str "Status", data str "Provisional" } } }, create-date std { year 2002, month 1, day 10 }, source { genome genomic, org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } }, orgname { name binomial { genus "Arabidopsis", species "thaliana" }, mod { { subtype ecotype, subname "Columbia" }, { subtype old-name, subname "Arabidopsis thaliana", attrib "(10)cultivar=Columbia" } }, lineage "Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids; eurosids II; Brassicales; Brassicaceae; Arabidopsis", gcode 1, mgcode 1, div "PLN" } }, subtype { { subtype chromosome, name "4" }, { subtype map, name "unknown" }, { subtype clone, name "CHR4v01212004" } } }, comment "", update-date std { year 2005, month 1, day 25 } }, inst { repr raw, mol aa, length 333, seq-data ncbieaa "MSISVVDSSLCHPTASFPSSMVHSNRFSKRISGNGNWVRERRRLYVKSSN SEGKKEEAAQKSSSNNTSSFLSFLCPLLKVFSGGDPSQQRNHALEVATSSLASVARLPWGSRVSTGSIDNQDVSSNPP LRLQLFEFEACPFCRRVREAMTELDLSVEVYPCPKGSIRHRELVRRSGGKEMFPFLVDPNTETLMYESGDIVKYLFKQ YGNGRGPSTGLLESTLFTGWMPTLLRAGRGMSLWDKASTDLPPKMLELFSYENNPYSRLVREALCELELPYVLHNIGE GSTRMKSLLNASGSNKVPFLVDPNTGVQLGDYEKILAYLFKTYSSAAFA" }, annot { { data ftable { { data prot { name { "expressed protein" } }, location int { from 0, to 332, strand plus, id gi 18413285 } } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 18413285, location int { from 103, to 1104, strand plus, id gi 42566377 } } } } } }, seq { id { other { accession "NP_612463", version 1 }, gi 19923987 }, descr { title "thioredoxin-like 6 [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 212, seq-data ncbistdaa '0C01110B06110710090B09100D0D11040F04050B04120501 05131110100B050D100B130B0B060607010701030E0F030F0106130E090B0A04060613100B1204 050616130B1001010F0B010B131613110F04111205050F0F040B060B0A040C0E0A0A140B060B0E 060504040B1010040B07100F06111305100B0E011313130B0A0E040704130B1210040701040509 0F100B0712010306010D140F05010105130B04100D060F0B0E05040B05040F050E10110B120503 0B1010080A161013050A010110070710040E0707070707050507070107070B06'H } }, seq { id { genbank { accession "AAM14290", version 1 }, gi 20259149 }, descr { title "unknown protein [Arabidopsis thaliana]", source { org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } } } } }, inst { repr raw, mol aa, length 300, seq-data ncbistdaa '0C0411101311090B06130301090113110306121107110111 110E1304061113030D160506050B061006040B05010A030E0E110B160E120E0E09051304070411 0B04100B0C01110F08070D01160C11130B0616011114030E0611100113100E0A06040C0B11110C 060E0F090F080B01130508110F010B0E111306111016070908110B0E11090B0C130D0F120B0D01 10160807100A040B09110B0905061605050112070B0F0E130F1613010507050E12070B0D010704 070D0B0912140B100A07121109100509060A0F040E060B130B110B0B0609030B0F0C01090B1306 0E09010511100C10010B1401111613010D0B0D0B071006070509110F0B060D100709080C130413 10100B140B0A0B110B130A12100D06080510010A0D010F01140111110B011113110B070F121111 040F11'H } }, seq { id { swissprot { name "FAF1_HUMAN", accession "Q9UNN5" }, gi 20454906 }, descr { title "FAS-associated factor 1 (FAF1 protein) (hFAF1) (CGI-03).", sp { class standard, extra-acc { "Q9UF34", "Q9UNT3", "Q9Y2Z3" }, seqref { gi 5805207, gi 5805208, gi 5805195, gi 5805196, gi 6729589, gi 6729590, gi 4680646, gi 4680647, gi 13436376, gi 13436377, gi 45501217, gi 45501218, gi 6599274, gi 6599275, gi 7512420, gi 11292646, gi 13399997 }, dbref { { db "Ensembl", tag str "ENSG00000185104" }, { db "Genew", tag str "HGNC:3578" }, { db "MIM", tag str "604460" }, { db "GO", tag str "GO:0005515" }, { db "GO", tag str "GO:0006915" }, { db "InterPro", tag str "IPR006577" }, { db "InterPro", tag str "IPR001012" }, { db "Pfam", tag str "PF00789" }, { db "SMART", tag str "SM00594" }, { db "SMART", tag str "SM00166" }, { db "PROSITE", tag str "PS50033" } }, keywords { "3D-structure", "Alternative splicing", "Apoptosis", "Nuclear protein" }, created std { year 2003, month 2, day 28 }, sequpd std { year 2003, month 2, day 28 }, annotupd std { year 2005, month 5, day 1 } }, comment "[FUNCTION] Potentiates but cannot initiate FAS-induced apoptosis.", comment "[SUBUNIT] Specifically interacts with the cytoplasmic domain of FAS.", comment "[SUBCELLULAR LOCATION] Nuclear (Potential).", comment "[ALTERNATIVE PRODUCTS] Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=Q9UNN5-1; Sequence=Displayed; Name=Short; Synonyms=hFAF1(s); IsoId=Q9UNN5-2; Sequence=VSP_006704; Note=No experimental confirmation available;", comment "[TISSUE SPECIFICITY] Most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon. Not detected in the peripheral blood leukocytes.", comment "[SIMILARITY] Contains 1 UBX domain.", create-date std { year 2003, month 2, day 28 }, update-date std { year 2005, month 5, day 1 }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } }, molinfo { biomol peptide, completeness complete }, pub { pub { gen { serial-number 1 }, pmid 10462485, article { title { name "Identification and characterization of human Fas associated factor 1, hFAF1." }, authors { names std { { name name { last "Ryu", initials "S.W." } }, { name name { last "Chae", initials "S.K." } }, { name name { last "Lee", initials "K.J." } }, { name name { last "Kim", initials "E." } } }, affil str "Division of Life Science, PaiChai University, 439-6 Doma-dong, Seo-gu, Taejon, 302-735, South Korea." }, from journal { title { iso-jta "Biochem. Biophys. Res. Commun.", ml-jta "Biochem Biophys Res Commun", issn "0006-291X", name "Biochemical and biophysical research communications." }, imp { date std { year 1999, month 8, day 27 }, volume "262", issue "2", pages "388-394", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 1999, month 8, day 27 } }, { pubstatus medline, date std { year 1999, month 8, day 27, hour 0, minute 1 } } } } }, ids { pubmed 10462485, doi "10.1006/bbrc.1999.1217", pii "S0006291X99912172" } } }, comment "NUCLEOTIDE SEQUENCE (ISOFORMS LONG AND SHORT), AND CHARACTERIZATION.~TISSUE=Brain, and Liver" }, pub { pub { gen { serial-number 2 }, sub { authors { names std { { name name { last "Boldyreff", initials "B." } } }, affil str "to the EMBL/GenBank/DDBJ databases" }, medium other, date std { year 2000, month 1 } } }, comment "NUCLEOTIDE SEQUENCE (ISOFORM LONG)." }, pub { pub { gen { serial-number 3 }, pmid 10810093, article { title { name "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." }, authors { names std { { name name { last "Lai", initials "C.H." } }, { name name { last "Chou", initials "C.Y." } }, { name name { last "Ch'ang", initials "L.Y." } }, { name name { last "Liu", initials "C.S." } }, { name name { last "Lin", initials "W." } } }, affil str "Institute of Biomedical Sciences, Academia Sinica, Taipei 115, Taiwan, Republic of China." }, from journal { title { iso-jta "Genome Res.", ml-jta "Genome Res", issn "1088-9051", name "Genome research." }, imp { date std { year 2000, month 5 }, volume "10", issue "5", pages "703-713", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2000, month 5, day 16, hour 9, minute 0 } }, { pubstatus medline, date std { year 2000, month 8, day 29, hour 11, minute 1 } } } } }, ids { pubmed 10810093 } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG)." }, pub { pub { gen { serial-number 4 }, pmid 12477932, article { title { name "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." }, authors { names std { { name name { last "Strausberg", initials "R.L." } }, { name name { last "Feingold", initials "E.A." } }, { name name { last "Grouse", initials "L.H." } }, { name name { last "Derge", initials "J.G." } }, { name name { last "Klausner", initials "R.D." } }, { name name { last "Collins", initials "F.S." } }, { name name { last "Wagner", initials "L." } }, { name name { last "Shenmen", initials "C.M." } }, { name name { last "Schuler", initials "G.D." } }, { name name { last "Altschul", initials "S.F." } }, { name name { last "Zeeberg", initials "B." } }, { name name { last "Buetow", initials "K.H." } }, { name name { last "Schaefer", initials "C.F." } }, { name name { last "Bhat", initials "N.K." } }, { name name { last "Hopkins", initials "R.F." } }, { name name { last "Jordan", initials "H." } }, { name name { last "Moore", initials "T." } }, { name name { last "Max", initials "S.I." } }, { name name { last "Wang", initials "J." } }, { name name { last "Hsieh", initials "F." } }, { name name { last "Diatchenko", initials "L." } }, { name name { last "Marusina", initials "K." } }, { name name { last "Farmer", initials "A.A." } }, { name name { last "Rubin", initials "G.M." } }, { name name { last "Hong", initials "L." } }, { name name { last "Stapleton", initials "M." } }, { name name { last "Soares", initials "M.B." } }, { name name { last "Bonaldo", initials "M.F." } }, { name name { last "Casavant", initials "T.L." } }, { name name { last "Scheetz", initials "T.E." } }, { name name { last "Brownstein", initials "M.J." } }, { name name { last "Usdin", initials "T.B." } }, { name name { last "Toshiyuki", initials "S." } }, { name name { last "Carninci", initials "P." } }, { name name { last "Prange", initials "C." } }, { name name { last "Raha", initials "S.S." } }, { name name { last "Loquellano", initials "N.A." } }, { name name { last "Peters", initials "G.J." } }, { name name { last "Abramson", initials "R.D." } }, { name name { last "Mullahy", initials "S.J." } }, { name name { last "Bosak", initials "S.A." } }, { name name { last "McEwan", initials "P.J." } }, { name name { last "McKernan", initials "K.J." } }, { name name { last "Malek", initials "J.A." } }, { name name { last "Gunaratne", initials "P.H." } }, { name name { last "Richards", initials "S." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Hale", initials "S." } }, { name name { last "Garcia", initials "A.M." } }, { name name { last "Gay", initials "L.J." } }, { name name { last "Hulyk", initials "S.W." } }, { name name { last "Villalon", initials "D.K." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Sodergren", initials "E.J." } }, { name name { last "Lu", initials "X." } }, { name name { last "Gibbs", initials "R.A." } }, { name name { last "Fahey", initials "J." } }, { name name { last "Helton", initials "E." } }, { name name { last "Ketteman", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Rodrigues", initials "S." } }, { name name { last "Sanchez", initials "A." } }, { name name { last "Whiting", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Young", initials "A.C." } }, { name name { last "Shevchenko", initials "Y." } }, { name name { last "Bouffard", initials "G.G." } }, { name name { last "Blakesley", initials "R.W." } }, { name name { last "Touchman", initials "J.W." } }, { name name { last "Green", initials "E.D." } }, { name name { last "Dickson", initials "M.C." } }, { name name { last "Rodriguez", initials "A.C." } }, { name name { last "Grimwood", initials "J." } }, { name name { last "Schmutz", initials "J." } }, { name name { last "Myers", initials "R.M." } }, { name name { last "Butterfield", initials "Y.S." } }, { name name { last "Krzywinski", initials "M.I." } }, { name name { last "Skalska", initials "U." } }, { name name { last "Smailus", initials "D.E." } }, { name name { last "Schnerch", initials "A." } }, { name name { last "Schein", initials "J.E." } }, { name name { last "Jones", initials "S.J." } }, { name name { last "Marra", initials "M.A." } }, { name consortium "Mammalian Gene Collection Program Team" } }, affil str "National Cancer Institute, Bethessda, MD 20892-2580, USA. rls@nih.gov" }, from journal { title { iso-jta "Proc. Natl. Acad. Sci. U.S.A.", ml-jta "Proc Natl Acad Sci U S A", issn "0027-8424", name "Proceedings of the National Academy of Sciences of the United States of America." }, imp { date std { year 2002, month 12, day 24 }, volume "99", issue "26", pages "16899-16903", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2002, month 12, day 13, hour 4, minute 0 } }, { pubstatus medline, date std { year 2003, month 1, day 22, hour 4, minute 0 } }, { pubstatus aheadofprint, date std { year 2002, month 12, day 11 } } } } }, ids { pubmed 12477932, doi "10.1073/pnas.242603899", pii "242603899" } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG).~TISSUE=Brain, and Kidney" }, pub { pub { gen { serial-number 5 }, sub { authors { names std { { name consortium "The German cDNA consortium" } }, affil str "to the EMBL/GenBank/DDBJ databases" }, medium other, date std { year 1999, month 12 } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 97-650 (ISOFORM LONG).~TISSUE=Testis" }, pub { pub { gen { serial-number 6 }, pmid 11243799, article { title { name "The UBX domain: a widespread ubiquitin-like module." }, authors { names std { { name name { last "Buchberger", initials "A." } }, { name name { last "Howard", initials "M.J." } }, { name name { last "Proctor", initials "M." } }, { name name { last "Bycroft", initials "M." } } }, affil str "MRC Centre for Protein Engineering, Department of Chemistry, University of Cambridge, Lensfield Road, Cambridge CB2 1EW, UK." }, from journal { title { iso-jta "J. Mol. Biol.", ml-jta "J Mol Biol", issn "0022-2836", name "Journal of molecular biology." }, imp { date std { year 2001, month 3, day 16 }, volume "307", issue "1", pages "17-24", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2001, month 3, day 13, hour 10, minute 0 } }, { pubstatus medline, date std { year 2001, month 5, day 1, hour 10, minute 1 } } } } }, ids { pubmed 11243799, doi "10.1006/jmbi.2000.4462", pii "S0022283600944620" } } }, comment "STRUCTURE BY NMR OF 569-650." } }, inst { repr raw, mol aa, length 650, seq-data ncbieaa "MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENG ILQSEYGGETIPGPAFNPASHPASAPTSSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDTCTVGEIKQI LENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHAGALQESLNQNFMLIITHREVQRE YNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDSMCLAESGLSYPCHRLTVGRRSSPAQTREQSEEQITD VHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQ EAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTI RTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDIKDEDEREARENVKREQDEAYRLS LEADRAKREAHEREMAEQFRLEQIRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKL QIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE", hist { replaces { date std { year 2005, month 3, day 15 }, ids { gi 7512420, gi 11292646 } } } }, annot { { data ftable { { data region "Domain", comment "UBX.", location int { from 568, to 645, id gi 20454906 }, exp-ev experimental }, { data region "Splicing variant", comment "Missing (in isoform Short). /FTId=VSP_006704.", location int { from 187, to 338, id gi 20454906 }, exp-ev experimental }, { data region "Conflict", comment "F -> K (in Ref. 1).", location pnt { point 447, id gi 20454906 }, exp-ev experimental }, { data region "Conflict", comment "E -> G (in Ref. 1).", location pnt { point 497, id gi 20454906 }, exp-ev experimental }, { data region "Conflict", comment "H -> R (in Ref. 1).", location pnt { point 528, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location int { from 573, to 578, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location int { from 580, to 581, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location int { from 584, to 589, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location int { from 591, to 592, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location pnt { point 594, id gi 20454906 }, exp-ev experimental }, { data region "Helical region", location int { from 595, to 605, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location pnt { point 606, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location int { from 612, to 616, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location int { from 617, to 620, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location int { from 621, to 622, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location int { from 623, to 625, id gi 20454906 }, exp-ev experimental }, { data region "Hydrogen bonded turn", location int { from 628, to 629, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location pnt { point 631, id gi 20454906 }, exp-ev experimental }, { data region "Helical region", location int { from 632, to 635, id gi 20454906 }, exp-ev experimental }, { data region "Beta-strand region", location int { from 640, to 647, id gi 20454906 }, exp-ev experimental }, { data gene { locus "FAF1;" }, location int { from 0, to 649, id gi 20454906 } }, { data prot { name { "FAS-associated factor 1" } }, location int { from 0, to 649, id gi 20454906 } } } } } }, seq { id { swissprot { name "NUHM_HUMAN", accession "P19404" }, gi 20455499 }, descr { title "NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial precursor", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 249, seq-data ncbistdaa '0C06061101010B1001100101070B1201081407100813100D 0B080A12130C0F0D07010707010B0613081004120E050D0D0E04120E060406120E050D160A1009 050109130A0D160E0507080A010101130B0E130B040B010F100F0D07140B0E0911010C0D0A1301 05130B0F130E0E0C101316051301120616120C160D100A0E13070A1608090F13031212120E030C 0B100D110411090B0501090F0A0A0B07090A13070512120E040A0B06120B09051305030B070103 130D010E0C130F090D040D161605040B12010A04090505090904050B0A01070A090E0A0E070E10 110710061103050E0107070B12110B12050E0E0A070E070607130F01070B'H } }, seq { id { genbank { accession "AAN03798", version 1 }, gi 22652727 }, descr { title "tungsten-containing formate dehydrogenase beta subunit [Methylobacterium extorquens]", source { org { taxname "Methylobacterium extorquens", common "Methylobacterium extorquens", db { { db "taxon", tag id 408 } } } } }, inst { repr raw, mol aa, length 572, seq-data ncbistdaa '0C1105011107121310110601080E071007100D1301100113 0E0A07100F13040E08010A13050905050B0B0712100E100F10040B0B0905080B080B090F041216 070F09110104080B01010B0104050C110B0106010513060512011206160108060413130A050705 0104090E100B12091013030411091203010C06070104050B0B05120B0F10050B01110401131013 1310010E0313070B030408010E0113051307080D060B081001040B011113100101130501050412 080108090E121613041604011610010707071601120B05100B101107050B0E130404130B0A130B 040407070B10070B07070107060E1207100A141011131007050E070E100B0C01130D0704050705 0E0712060A040F0B160B0D12040E0810060B05070C0B09070108131305010104131609160B1004 05160E09111005090B01100509010A0B0E050707121009080B1010070107011609030705051111 0B0905110B05070A10070B0E10080A0E0E060E060F13070B060D100E120B090D0D0905120B0614 1310040B09051007010514140A110807100D071013070B1011161113110710130A050E07130A0B 010E01070B12090F050B09040516030707091104070811060101160B0E070701110707090B0E01 110C0D04090E0B040607120B050A1607030609071101011313090B11040F040413100701010B0D 0B0C0A06060504051103070F03120E03101107120F0A01100C0B0C050D0713140412040B0B0705 0B010F030C100401110903070B070F0101110D0E13111213090A16060E040B060E050E10011301 0105'H } }, seq { id { swissprot { name "BCP_BUCAP", accession "Q9ZHF0" }, gi 22654216 }, descr { title "Bacterioferritin comigratory protein", source { org { taxname "Buchnera aphidicola (Schizaphis graminum)", common "Buchnera aphidicola (Schizaphis graminum)", db { { db "taxon", tag id 98794 } } } } }, inst { repr raw, mol aa, length 158, seq-data ncbistdaa '0C12120B0A0E070409010E0A06090B0E0D0309040A11090A 0B1104060B070A0A130B131606160E0A010C120E070312130F01030D0910040D0B050B060A110A 0A1305130B0709110E040D120D0A0B0B120613050A0A0C0B0D06120B0B11040A0F0D0913110A0A 0607131407050A09060C070A0A1606070916101211060B090D1111070609040A0906060A060A03 0A0408080A09090B12160B0D110A0A1104'H } }, seq { id { swissprot { name "APR1_ARATH", accession "P92979" }, gi 24211445 }, descr { title "5'-adenylylsulfate reductase 1, chloroplast precursor (Adenosine 5'-phosphosulfate 5'-adenylylsulfate sulfotransferase 1) (APS sulfotransferase 1) (Thioredoxin independent APS reductase 1) (3 '-phosphoadenosine-5'-phosphosulfate reductase homolog 19) (PAPS reductase homolog 19) (Prh-19)", source { org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } } } } }, inst { repr raw, mol aa, length 465, seq-data ncbistdaa '0C010C11130D131111111111110709090D1110060713110B 050E0A13110F0907110B100B0B0410130813010E13110B0D0B11070A10111111130A0E0B0D0105 0E0A120A04110C090E0B0101120C1301050901050513051313050905040605050B010A0A0B050D 01110E0B05090C040A010B050A16070D040901090106110701050413010B09051601080B120710 0E06101306110B041207100B0D0E051216100606040113050A08160709100905160C060E041113 05130F070B1310110A070B06110616050407080F0503031013100A13100E0B1010010B0A070B0A 01140912070F100A040F110E0712101105090E13130F13040E130605070B0407071307110B130A 140D0E13010D1305070D0413140D060B10120C04130E130D120B08010107160911090703050E03 120A01130B0E070F0805100507101414140504010A010A0503070B080A070D130A050D11040401 0A130D0705110A110113010409060A11050D0B13120B11100F0709050D0B0C0A0B050D100A050E 140913130B16010E14030E06030F010C0501111604050B01040A0B01071107090A13010A061001 0407040F0A0506010A0F050B0F0B0711060E12090B13060E0A0D1111100E090A160E11050A1004 1305110B1211060B0D0B1310'H } }, seq { id { other { accession "NP_061854", version 1 }, gi 24308127 }, descr { title "DnaJ (Hsp40) homolog, subfamily C, member 10 [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 793, seq-data ncbistdaa '0C0713140B0D0A0404160910040B0A1009090B03060B0913 160C01090B130712040F040616110B0B0713110A12011111100509100F01060A0A0B010B0A0B08 0E040A0D0E0D0D0E0D01080704060B0A090D10011605130B0A0405040B100A0A16040A1607050A 070B05040D0F07070F160511140D1616101604060709160404040E050909120B05101005060401 01130D1107050B1406130D0616110E070311080308040B010E1214100406010A051304070B0B10 090701130D03070404100C0B03100C0A07130D11160E110B0609061011070C010E130A16080704 10110A05110B131106010C0F08131011121312050B1412070D06130D11090F1201060101070907 140B09120603110A070704030B12110F12100B100B11070C0B04070B130D1307140C040301120F 040D0B030A110B040912121112120116060E0E0701120B0D0D0A050A0D11090B060B0D110B0401 0A0509160B051309080D0B0E0406050B0B11010D120B0504100B01080810140B0B06060806070A 0D050D110D040E050B0A0A0B0A120B0B0A0D0408090F1307100604031111010E040903110D0B16 13060F0E110B0113060A070F07120A051605090808070A0A090B1604090B0106010A0511130D11 081312120B070E0F0D060E010D040A050E140B13040606010E14030E0E0310010B0B0E050B1010 01110D0B0B16070F0B0A0607120B040312130805070B030D0C160D090F01160E12121313060D0F 110D09080516050708081101050F090B05060905040B0C0D0E111313110B120E1212060D050B13 120F100A080D0513140C13040616110E1403080E030F130B0C0E05140A100C0110120B12070B09 0D1307110904030F0F1608110603010F050D130F10160E05091006060E0E0A110D0A0116081608 11160D07140D10040116110B100914070B07060B0E0F131112040B120E0F120611050A130B0F07 0A0D08141309040616010E1403070E030F0D06010E0506050B0B01100C090A070A130A01070A13 04030F0116010F12030F0A0107091001160E12130A061606160510010A100D060F05050F090D12 1004010A010901010B0911050A0B05120B100D0F070A100D0A04050B'H } }, seq { id { ddbj { accession "BAC22491", version 1 }, gi 24414114 }, descr { title "ETEA [Homo sapiens]", molinfo { biomol peptide }, create-date std { year 2002, month 10, day 26 }, pub { pub { sub { authors { names std { { name name { last "Oshida", initials "T." } }, { name name { last "Imai", initials "Y." } }, { name name { last "Oya", initials "Y." } }, { name name { last "Sugita", initials "Y." } } }, affil str "Tadahilo Oshida, Genox Research, Inc.; Miyamae, Nogawa 907, Kawasaki, Kanagawa 216-0001, Japan (E-mail:oshidata@genox.co.jp, URL:http://www.genox.co.jp/, Tel:81-44-797-2281, Fax:81-44-797-2622)" }, medium email, date std { year 2002, month 7, day 11 } } } }, pub { pub { muid 22259380, article { title { name "Cloning and characterization of the highly expressed ETEA gene from blood cells of atopic dermatitis patients." }, authors { names std { { name name { last "Imai", initials "Y." } }, { name name { last "Nakada", initials "A." } }, { name name { last "Hashida", initials "R." } }, { name name { last "Sugita", initials "Y." } }, { name name { last "Tanaka", initials "T." } }, { name name { last "Tsujimoto", initials "G." } }, { name name { last "Matsumoto", initials "K." } }, { name name { last "Akasawa", initials "A." } }, { name name { last "Saito", initials "H." } }, { name name { last "Oshida", initials "T." } } }, affil str "Genox Research, Inc., Teikyo University Biotech Center, 907 Nogawa, Miyamae, Kawasaki, 216-0001, Kanagawa, Japan." }, from journal { title { iso-jta "Biochem. Biophys. Res. Commun.", ml-jta "Biochem Biophys Res Commun", issn "0006-291X", name "Biochemical and biophysical research communications." }, imp { date std { year 2002, month 10, day 11 }, volume "297", issue "5", pages "1282-1290", language "eng" } }, ids { pubmed 12372427, medline 22259380 } }, pmid 12372427 }, reftype no-target }, update-date std { year 2002, month 10, day 26 }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } }, subtype { { subtype cell-type, name "T cells" } } } }, inst { repr raw, mol aa, length 445, seq-data ncbieaa "MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDR LNEQEGVPSVFNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRFIRPDPRSR VTDPVGDIVSFMHSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVISLINTRM LFWACSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERN QTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECLPPEPSPDDPESV KIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEVLFVQ DLTDE" }, annot { { data ftable { { data prot { name { "ETEA" } }, location whole gi 24414114 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 24414114, location int { from 6, to 1343, id gi 24414113 } } } } } }, seq { id { swissprot { name "GST2_YEAST", accession "Q12390" }, gi 26394420 }, descr { title "Glutathione S-transferase II (GST-II)", source { org { taxname "Saccharomyces cerevisiae", common "baker's yeast", db { { db "taxon", tag id 4932 } } } } }, inst { repr raw, mol aa, length 233, seq-data ncbistdaa '0C0D071007060B09160D0707050A0C0A0F0A0C0909160412 0E01070E160E0110131009010B01050A0D0C0B1111130F061310090D0B140A0705080A0A0E0506 0B010A0D16110712130E130B050B040407120B090105031201091205160904010B0407120E120B 12070A120E0B050A071309080C0C0D0A1001050B050B0B040E1311131606080801120E070B070E 0513050B160F0D0A0514070B100F10040A010B08070C0816060412130B1005100E161301070411 06110C01040912130901070B0906010109130A0B0F130E05050305010B100114160A100C0F0F10 0E11130A0A0B0B050910110A1111'H } }, seq { id { swissprot { name "TXN5_HUMAN", accession "Q8NBS9" }, gi 29839560 }, descr { title "Thioredoxin domain containing protein 5 precursor (Thioredoxin-like protein p46) (Endoplasmic reticulum protein ERp46) (UNQ364/PRO700)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 432, seq-data ncbistdaa '0C0E01100E07100B0B0E0B0B01100E01010B12010B0B0B0B 0B0B0708070707071014070110010F0501010101010104070E0E010104070504070F040E08110A 080B161201040C06120807090F1101010806130C0606010E14030708030F100B0F0E12140D040B 07040A160D110C0504010A131613010A1304031201081104130311010F07131007160E120B0A0B 060A0E070F0501130A160F070E1004060F120B050D140C0B0F120B0D05050E13120E050E051305 0E0E11010E050B0A0F070B16050B1101110D06050B0813010F07040806090A0606010E14030708 030A010B010E1214050F0B010B070B0508110512130A09070A130403120F0816050B0311070D0F 131007160E120B0B14061004070A0A13040F160A070A10040B05110B1005161305110F0B0F1012 0512070112051213120E1105010E130B0101050E0501040A0712130B010B12050D0D0604041209 010507091206090A0616010E14030708030A120B010E121405050B110A0A05060E070B0107130A 090105130403120105100D0903110A1611131007160E120B0B0B061007070A0A13110508110707 10040B04110B081006130B110F010A04050B'H } }, seq { id { swissprot { name "TXN4_HUMAN", accession "Q9BS26" }, gi 31077035 }, descr { title "Thioredoxin domain containing protein 4 precursor (Endoplasmic reticulum protein ERp44)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 406, seq-data ncbistdaa '0C080E0113060B110B0E040B1003110B0B0B0B1312141306 120E131212050912110B0412050D090405090B0D0D010413010B130D0616010414031006110F0C 0B080E0906050501110413090A0505060E0D050D0F1313060110130403040F08110409010F1016 1009110A160E120B0A0B06100D070C0C0C0A10051610070F1011130A010B01041609100F0F0A11 040E090F050910040B01050912120B0410110A100D0909071606050F0A0411040D161013060510 13010D090B0804040301060B110106070413110A0E0510161107040D0909160A0E0E070811010E 040C13160B07010C120D06041312160D14090F040A03130E0B131005091206050D0705050B1205 05070B0E060B090B06080C0A05041205110B0509060F0D051301100F0B0911050A0712090D060B 08010403040A0610080E0B0B08090F0A120E0104030E1309010904110610080C1613060704060A 04130B090E070A0B0A0F061306040B0811070A0B081005060808070E040E120412010E07050F01 0F04130111110E0E051111060F0A0B010E1105161016120B0B10041004050B'H } }, seq { id { genbank { accession "AAP54320", version 1 }, gi 31432722 }, descr { title "hypothetical protein [Oryza sativa (japonica cultivar-group)]", source { org { taxname "Oryza sativa (japonica cultivar-group)", common "Japanese rice", db { { db "taxon", tag id 39947 } } } } }, inst { repr raw, mol aa, length 704, seq-data ncbistdaa '0C070505120B13010C0E0B010E0E08080808080801080B0E 010B0E080B01010E0E0E0E0E0E0E0E010512050B12050F10050505130E13040413130501010104 130E10100505070B131304070705041316160110100C0B0F0713130B100E0E0E080B0E0F0E0501 0E0E070B1210010B11010E010E0407161305050505050F100E130510110111130D110101110113 13130413011109071006061004101004130B111101091210100911110B0A05011111110E0E0E0E 13070C04121607130F0509080B0E0D130A131213100B0A04010905010401050504040113070707 0704040716110611071108090A071013110606111011070310040301011310010606100F11010B 0E161305090D0B0413060E051005010506011110010701110110130E0F09060B0D050A0B0B0707 0B13130B0D110B100D110705060510101310040B01071010030E0412010E10130E13160706040D 040E070A05070704100504010C1307091310130B1008100B0E090F04100913100B0A0B130A0D03 06110701040C13040709130D080B050311100A0A011305090710050B01100A0806090808130610 050D0406050407110F0D0B1610060B0508040E01090E0A16160D0609100701120D0407050E0A0B 01010109070F100C120A090C1301090B050116011104041010080B041611100901011105050610 1016010D0C130F050B0F1013040C11010B0E010505100B0E06060B0D0B080D010C010908011313 1013070F0E0701090410101111110D060F1613130707080E16110B011209100D07090B10110D10 100F0E161209010A0E06071111040A100B050B130F070A130D0E0B130806070B03040112101111 0E091310060611120F0713050E050B10080101100A06060B0D0707130509040B0511101213080B 121109090A141611130406070F041005120B0A14090B0D160B040E120A01070B0B12080B0B0D04 070701090D0911160B0D160414110B0D13'H } }, seq { id { other { accession "NP_073738", version 2 }, gi 31542723 }, descr { molinfo { biomol peptide }, title "sperm protein SSP411 [Homo sapiens]", create-date std { year 2001, month 1, day 23 }, source { genome genomic, org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } }, subtype { { subtype chromosome, name "17" }, { subtype map, name "17q21.33" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Provisional" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "BC025255.1" }, { label str "gi", data int 19263653 } } } } }, { label str "Related", data fields { { label id 0, data fields { { label str "accession", data str "AK025000.1" }, { label str "gi", data int 10437433 } } } } } } }, pub { pub { pmid 15223837, article { title { name "Cloning and characterization of rat spermatid protein SSP411: a thioredoxin-like protein." }, authors { names std { { name name { last "Shi", initials "H.J." } }, { name name { last "Wu", initials "A.Z." } }, { name name { last "Santos", initials "M." } }, { name name { last "Feng", initials "Z.M." } }, { name name { last "Huang", initials "L." } }, { name name { last "Chen", initials "Y.M." } }, { name name { last "Zhu", initials "K." } }, { name name { last "Chen", initials "C.L." } } }, affil str "Center for Biomedical Research, Population Council, Beijing, P.R. China." }, from journal { title { iso-jta "J. Androl.", issn "0196-3635" }, imp { date std { year 2004, month 7 }, volume "25", issue "4", pages "479-493", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2004, month 6, day 30, hour 5, minute 0 } }, { pubstatus medline, date std { year 2004, month 6, day 30, hour 5, minute 0 } } } } }, ids { pubmed 15223837 } } } }, update-date std { year 2005, month 4, day 23 } }, inst { repr raw, mol aa, length 802, seq-data ncbieaa "MLGARAWLGRVLLLPRAGAGLAASRRCPGVWPRTWPHRSPSRGSSSRDKD RSATVSSSVPMPAGGKGSHPSSTPQRVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTCHW CHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLT RVGFRTVLLRIREQWKQNKNTLLENSQRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKF PTPVILSFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQLAVAYS QAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLT SGQLLMKHYGLTEAGNISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKHRPKPHLDS KMLAAWNGLMVSGYAVTGAVLGQDRLINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFV VRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHG FTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILAD GDPSSFLSRQLPFLSTLRRLEDQATAYVCENQACSVPITDPCELRKLLHP", hist { replaces { date std { year 2003, month 6, day 9 }, ids { gi 12383068 } } } }, annot { { data ftable { { data prot { name { "sperm protein SSP411", "transcript increased in spermiogenesis 78" } }, location whole gi 31542723 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 31542723, location int { from 8, to 2416, strand plus, id gi 31542722 }, ext { type str "GeneOntology", data { { label str "Function", data fields { { label id 0, data fields { { label str "text string", data str "hydrolase activity, acting on glycosyl bonds" }, { label str "go id", data str "0016798" }, { label str "evidence", data str "IEA" } } } } }, { label str "Process", data fields { { label id 0, data fields { { label str "text string", data str "carbohydrate metabolism" }, { label str "go id", data str "0005975" }, { label str "evidence", data str "IEA" } } } } } } }, dbxref { { db "CCDS", tag str "CCDS11571.1" } } } } } } }, seq { id { gi 33149331, other { accession "NP_071908", version 2 } }, descr { title "nucleoredoxin [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 435, seq-data ncbistdaa '0C1107060B05050B0B07050A0B1312070707050513041308 110B0701100709110B0B070B16060703110B11010E03010F0B1101110B0101061607100B100704 010101070E070E0701070107010101050E050E1010100B05091306131111040F040F100F140F04 061310040C0E140B010B0E160A050A08100A0B0A0B140D0A161009110D090E110B09060B040112 12070A131303100D070B0B13091004040E05070B05060E14070E0A0E061005130901070E0B0B10 0D0D070F110B051111110B05071108130713160611010814030E0E0310110B1210130B13051116 100A090A0501070F0D0605090906131101041011050511060A0F160611050C0E140B01130E1612 040501101011100B0D100B1607090F07090E120B090C0B040E0F0705130912100F07101305130B 0D040504031005060E14080E0A0E130B050B1104110D01010F0B0D05070E030B130B0613041105 04040705110501010A0F0B090F0E0901050A0909010A160A010A050505010E0B0B060613010705 04040C1204110B100416120D0B0E0501010E0B0B12090B040C110110010A16130C041305050912 0E010913050106130D04060B01050A0B0A0E050E09'H } }, seq { id { embl { accession "CAE46765", version 1 }, gi 34576294 }, descr { title "NADPH thioredoxin reductase [Oryza sativa (japonica cultivar-group)]", source { org { taxname "Oryza sativa (japonica cultivar-group)", common "Japanese rice", db { { db "taxon", tag id 39947 } } } } }, inst { repr raw, mol aa, length 488, seq-data ncbistdaa '0C011312100B01130101010B11010A010B10011101010E01 13040505010E01110E0E0E11040B070A0713050D0B1309090711070E0107161201010916010110 010D0B0A0E1313060507160F130707130E07070F0B0C1212120513050D060E07060E0407131207 0E040B0C040A0C100A0F010510140701050B080F0504130506130D130A11100E06130910111104 1005130A0308111309090112070101010A100B100B0E1005040506141110070911010301090304 0701110E0B060A070F130B0113130707070412011205050109160B120A1601100813080B0B1310 0A040F0B1001110A010C0F0410130B0D0D0E0D09121308060D12050113041313110D0E0A070F0C 1107090F0B0A1012041207050511130B05130A070B061607090708120E0D110F0B0B0F070F0904 0B0404010716090B1305050712010A1211130407130601010704130F04080514100F0113120101 071107031301010B11130510160B13010D040B0B130506080F0E131005050A050A050912041004 13050C070604091108120A0810070F16010B100A13160805110E100B1303130B1612110E120307 0E0310120B0A0E090B110A13090405160D050813080613050904090505040E0509010501010709 0C07120E03130F06060A0D0A050C0B1012131107130A0C0A0A05161005060905110D0A'H } }, seq { id { ddbj { accession "BAC91391", version 1 }, gi 35214022 }, descr { title "gll3450 [Gloeobacter violaceus PCC 7421]", source { org { taxname "Gloeobacter violaceus PCC 7421", common "Gloeobacter violaceus PCC 7421", db { { db "taxon", tag id 251221 } } } } }, inst { repr raw, mol aa, length 217, seq-data ncbistdaa '0C010B0E0B0B1309070D0A0D16111114110B100E140B010B 0A0F010716010605050B1009110B041201051210010F090B1208110E11070A130E130B09040707 0B10091405110B01090305161301050F0B0E0501070B140E01040E011310011301101113110305 0C0801070601010B1001070C0E0C0412100110081207140E0C110E01130C040409041009010D0B 14100303100C0F160707070704060B0607100612090104010C16010E13131210060C121607130B 0B0405040B071016030F010B0B010B010E060F0F140B050101100F050E05120B01130B100E'H } }, seq { id { gi 38257679, swissprot { name "GDAP1_HUMAN", accession "Q8TB36" } }, descr { source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } }, title "Ganglioside-induced differentiation-associated protein 1 (GDAP1)" }, inst { repr raw, mol aa, length 358, seq-data ncbistdaa '0C0110100F05050F1007110E0E0B10070A070A0104010513 0A0B090B1608141208110611110F0A13100B130901050A010B0A030507080413110B0E0B110508 0D050E14060C100B0D11120705130E130B090807050D0909030501120F090904160B050F12060B 040510120E100B0C0E040A05110C16160E10130F081610050B0B04110B0E0C0401161208070309 0B080E050B121304110C090E0116011212100910110F09070D120511050B0A0A0B0105050D0E04 0B0F05011609010A0F0A100B0A110A0B0B0408040D130A160B0A0A090B04050B050A130B040F13 0512050B0F10100D0505120E0505070F0F0E140B0307051106120B010413110B0113120B08100B 0A060B07060110100D14070D070A100E0D0B051216160510130B0A100A12060D0A130B0708130D 0D090B091101130B0E1201061013010A0A10010E0A130B0712120B1313070B0B01071307160601 060C0B06100A100B07110C090B010B100E100E0D1606'H } }, seq { id { other { accession "NP_061895", version 3 }, gi 38505222 }, descr { molinfo { biomol peptide }, title "thioredoxin domain containing 10 [Homo sapiens]", create-date std { year 2002, month 10, day 10 }, source { genome genomic, org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } }, subtype { { subtype chromosome, name "18" }, { subtype map, name "18q22" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Validated" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "BX647846.1" } } }, { label id 0, data fields { { label str "accession", data str "AL832341.1" } } } } } } }, pub { pub { pmid 15623505, article { title { name "Identification and characterization of a novel thioredoxin-related transmembrane protein of the endoplasmic reticulum." }, authors { names std { { name name { last "Haugstetter", initials "J." } }, { name name { last "Blicher", initials "T." } }, { name name { last "Ellgaard", initials "L." } } }, affil str "Institute of Biochemistry, ETH Zurich, Zurich CH-8093, Switzerland." }, from journal { title { iso-jta "J. Biol. Chem.", issn "0021-9258" }, imp { date std { year 2005, month 3, day 4 }, volume "280", issue "9", pages "8371-8380", language "eng", pubstatus ppublish, history { { pubstatus aheadofprint, date std { year 2004, month 12, day 28 } }, { pubstatus pubmed, date std { year 2004, month 12, day 30, hour 9, minute 0 } }, { pubstatus medline, date std { year 2005, month 4, day 9, hour 9, minute 0 } } } } }, ids { pii "M413924200", doi "10.1074/jbc.M413924200", pubmed 15623505 } } }, comment "GeneRIF: TMX3 is a thioredoxin-related transmembrane protein of the endoplasmic reticulum" }, update-date std { year 2005, month 4, day 23 } }, inst { repr raw, mol aa, length 454, seq-data ncbieaa "MAAWKSWTALRLCATVVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYA PWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHR VSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEYVTLKEMPAVLVFKDE TYFVYDEYEDGDLSSWINRERFQNYLAMDGFLLYELGDTGKLVALAVIDEKNTSVEHTRLKSIIQEVARDYRDLFHRD FQFGHMDGNDYINTLLMDELTVPTVVVLNTSNQQYFLLDRQIKNVEDMVQFINNILDGTVEAQGGDSILQRLKRIVFD AKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEVSKSENENQEQIEESKEQQEPSSGGSVVP TVQEPKDVLEKKKD", hist { replaces { date std { year 2003, month 11, day 25 }, ids { gi 31377472 } } } }, annot { { data ftable { { data prot { name { "thioredoxin domain containing 10", "thioredoxin-related transmembrane protein 3" } }, location whole gi 38505222 } } }, { data ftable { { data cdregion { code { id 1 } }, product whole gi 38505222, location int { from 135, to 1499, strand plus, id gi 38505221 }, ext { type str "GeneOntology", data { { label str "Function", data fields { { label id 0, data fields { { label str "text string", data str "isomerase activity" }, { label str "go id", data str "0016853" }, { label str "evidence", data str "IEA" } } }, { label id 0, data fields { { label str "text string", data str "electron transporter activity" }, { label str "go id", data str "0005489" }, { label str "evidence", data str "IEA" } } } } }, { label str "Process", data fields { { label id 0, data fields { { label str "text string", data str "electron transport" }, { label str "go id", data str "0006118" }, { label str "evidence", data str "IEA" } } } } } } } } } } } }, seq { id { other { accession "NP_946351", version 1 }, gi 39934075 }, descr { title "Nitrogenase-associated protein:Arsenate reductase and related [Rhodopseudomonas palustris CGA009]", source { org { taxname "Rhodopseudomonas palustris CGA009", common "Rhodopseudomonas palustris CGA009", db { { db "taxon", tag id 258594 } } } } }, inst { repr raw, mol aa, length 131, seq-data ncbistdaa '0C010A13130616050A0E070313070D01100F0A010B0B1201 110708050B0513100D0B0B01050E14121005120B100E060607040A0E0B090514060D0F11110E0A 130A01070109040601010B07130501010B010B0C0905040E0B0B0910100E0B0C0F110704101005 130706040F0112130801140B070B0F1207070E101306040703010C0404'H } }, seq { id { genbank { accession "AAR98730", version 1 }, gi 41056563 }, descr { title "SoxW precursor [Starkeya novella]", source { org { taxname "Starkeya novella", common "Starkeya novella", db { { db "taxon", tag id 921 } } } } }, inst { repr raw, mol aa, length 183, seq-data ncbistdaa '0C100B121010110B010B07011101010B0B0E0B0710011001 0112100B070404070B16130F041416130511060B040B010504050101010A010A100A090B010B0F 14110F1007030E0B030A100B081204160601040101090501161310050806041313080B04091607 1110051312040607070F120B11050A010B0107101601131001120E12060F060601011004070A13 01051301100C0E070B0B0E0A0E05060B010C06101613050107011605110107060501140C01010F 0A010B'H } }, seq { id { other { accession "NP_973876", version 1 }, gi 42571571 }, descr { title "expressed protein [Arabidopsis thaliana]", source { org { taxname "Arabidopsis thaliana", common "thale cress", db { { db "taxon", tag id 3702 } } } } }, inst { repr raw, mol aa, length 252, seq-data ncbistdaa '0C010111121313121213120807011111090B0E111012010B 01131111101006111106110E11100B0406110D0B101010130D010E110E10100B13131001011012 05110107130A0B070110010E0D06050B0E050E0B12070D0B140A0B050406050B160E110B0B130C 0609030D08030E061309080B0A0A0409130A0B030D06160C0A0A070B011313010911110D111313 12080E0F04070E05060C010504010A13060A160E060E160B160405110F05130110050607011303 120E0506060B160A0A040710100E06050B131608070F06040411100E11110D110E13120710040B 110B0109040B110B11030F0E090E110D0F0A0E1113070311090A14080E05120A11'H } }, seq { id { other { accession "ZP_00152853", version 2 }, gi 46141045 }, descr { title "COG3917: 2-hydroxychromene-2-carboxylate isomerase [Dechloromonas aromatica RCB]", source { org { taxname "Dechloromonas aromatica RCB", common "Dechloromonas aromatica RCB", db { { db "taxon", tag id 159087 } } } } }, inst { repr raw, mol aa, length 201, seq-data ncbistdaa '0C11050E0904061606040611110E1607160B0C11050A0904 011301010A0807100A131014080E130B0B071309060F01120711100E0E0104071311110A111216 0C060804060810110110080C07090E160D0E0E1110060E0B0E120F0D010110011616140B08070F 0403010B01100F060108011316100706061304040B041311110E0412130B040901010A0B070904 10010F0B0112010B0F010E05090A01100B0A040503040A010B010107130607110E081309090407 05010606070104100B0E0F090508140B0512070706'H } }, seq { id { other { accession "NP_997740", version 1 }, gi 47086881 }, descr { molinfo { biomol peptide }, title "metaxin 2 [Danio rerio]", create-date std { year 2004, month 5, day 9 }, source { genome genomic, org { taxname "Danio rerio", common "zebrafish", db { { db "taxon", tag id 7955 } }, orgname { name binomial { genus "Danio", species "rerio" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio", gcode 1, mgcode 2, div "VRT" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Provisional" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "AY289938.1" }, { label str "gi", data int 33149361 } } } } }, { label str "Related", data fields { { label id 0, data fields { { label str "accession", data str "AY577007.1" }, { label str "gi", data int 46403251 } } } } } } }, pub { pub { article { title { name "The zebrafish metaxin 3 gene (mtx3): cDNA and protein structure, and comparison to zebrafish metaxins 1 and 2." }, authors { names std { { name name { last "Adolph", initials "K.W." } } }, affil str "Department of Biochemistry, Molecular Biology and Biophysics, University of Minnesota, 6-155 Jackson Hall, 321 Church St. S.E., Minneapolis, MN 55455, USA. adolph001@umn.edu" }, from journal { title { iso-jta "Gene", ml-jta "Gene", issn "0378-1119", name "Gene." }, imp { date std { year 2004, month 4, day 14 }, volume "330", pages "67-73", language "eng", pubstatus ppublish, history { { pubstatus accepted, date std { year 2004, month 1, day 8 } }, { pubstatus revised, date std { year 2003, month 12, day 11 } }, { pubstatus received, date std { year 2003, month 11, day 6 } }, { pubstatus medline, date std { year 2004, month 8, day 7, hour 5, minute 0 } }, { pubstatus pubmed, date std { year 2004, month 4, day 17, hour 5, minute 0 } } } } }, ids { pii "S0378111904000198", doi "10.1016/j.gene.2004.01.005", pubmed 15087125 } }, pmid 15087125 } }, pub { pub { pmid 12477932, article { title { name "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." }, authors { names std { { name name { last "Strausberg", initials "R.L." } }, { name name { last "Feingold", initials "E.A." } }, { name name { last "Grouse", initials "L.H." } }, { name name { last "Derge", initials "J.G." } }, { name name { last "Klausner", initials "R.D." } }, { name name { last "Collins", initials "F.S." } }, { name name { last "Wagner", initials "L." } }, { name name { last "Shenmen", initials "C.M." } }, { name name { last "Schuler", initials "G.D." } }, { name name { last "Altschul", initials "S.F." } }, { name name { last "Zeeberg", initials "B." } }, { name name { last "Buetow", initials "K.H." } }, { name name { last "Schaefer", initials "C.F." } }, { name name { last "Bhat", initials "N.K." } }, { name name { last "Hopkins", initials "R.F." } }, { name name { last "Jordan", initials "H." } }, { name name { last "Moore", initials "T." } }, { name name { last "Max", initials "S.I." } }, { name name { last "Wang", initials "J." } }, { name name { last "Hsieh", initials "F." } }, { name name { last "Diatchenko", initials "L." } }, { name name { last "Marusina", initials "K." } }, { name name { last "Farmer", initials "A.A." } }, { name name { last "Rubin", initials "G.M." } }, { name name { last "Hong", initials "L." } }, { name name { last "Stapleton", initials "M." } }, { name name { last "Soares", initials "M.B." } }, { name name { last "Bonaldo", initials "M.F." } }, { name name { last "Casavant", initials "T.L." } }, { name name { last "Scheetz", initials "T.E." } }, { name name { last "Brownstein", initials "M.J." } }, { name name { last "Usdin", initials "T.B." } }, { name name { last "Toshiyuki", initials "S." } }, { name name { last "Carninci", initials "P." } }, { name name { last "Prange", initials "C." } }, { name name { last "Raha", initials "S.S." } }, { name name { last "Loquellano", initials "N.A." } }, { name name { last "Peters", initials "G.J." } }, { name name { last "Abramson", initials "R.D." } }, { name name { last "Mullahy", initials "S.J." } }, { name name { last "Bosak", initials "S.A." } }, { name name { last "McEwan", initials "P.J." } }, { name name { last "McKernan", initials "K.J." } }, { name name { last "Malek", initials "J.A." } }, { name name { last "Gunaratne", initials "P.H." } }, { name name { last "Richards", initials "S." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Hale", initials "S." } }, { name name { last "Garcia", initials "A.M." } }, { name name { last "Gay", initials "L.J." } }, { name name { last "Hulyk", initials "S.W." } }, { name name { last "Villalon", initials "D.K." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Sodergren", initials "E.J." } }, { name name { last "Lu", initials "X." } }, { name name { last "Gibbs", initials "R.A." } }, { name name { last "Fahey", initials "J." } }, { name name { last "Helton", initials "E." } }, { name name { last "Ketteman", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Rodrigues", initials "S." } }, { name name { last "Sanchez", initials "A." } }, { name name { last "Whiting", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Young", initials "A.C." } }, { name name { last "Shevchenko", initials "Y." } }, { name name { last "Bouffard", initials "G.G." } }, { name name { last "Blakesley", initials "R.W." } }, { name name { last "Touchman", initials "J.W." } }, { name name { last "Green", initials "E.D." } }, { name name { last "Dickson", initials "M.C." } }, { name name { last "Rodriguez", initials "A.C." } }, { name name { last "Grimwood", initials "J." } }, { name name { last "Schmutz", initials "J." } }, { name name { last "Myers", initials "R.M." } }, { name name { last "Butterfield", initials "Y.S." } }, { name name { last "Krzywinski", initials "M.I." } }, { name name { last "Skalska", initials "U." } }, { name name { last "Smailus", initials "D.E." } }, { name name { last "Schnerch", initials "A." } }, { name name { last "Schein", initials "J.E." } }, { name name { last "Jones", initials "S.J." } }, { name name { last "Marra", initials "M.A." } } }, affil str "National Cancer Institute, Bethessda, MD 20892-2580, USA. rls@nih.gov" }, from journal { title { iso-jta "Proc. Natl. Acad. Sci. U.S.A.", ml-jta "Proc Natl Acad Sci U S A", issn "0027-8424", name "Proceedings of the National Academy of Sciences of the United States of America." }, imp { date std { year 2002, month 12, day 24 }, volume "99", issue "26", pages "16899-16903", language "eng", pubstatus ppublish, history { { pubstatus aheadofprint, date std { year 2002, month 12, day 11 } }, { pubstatus medline, date std { year 2003, month 1, day 22, hour 4, minute 0 } }, { pubstatus pubmed, date std { year 2002, month 12, day 13, hour 4, minute 0 } } } } }, ids { pii "242603899", doi "10.1073/pnas.242603899", pubmed 12477932 } } } }, update-date std { year 2004, month 10, day 20 } }, inst { repr raw, mol aa, length 274, seq-data ncbieaa "MSLAAEAFVSQIAAAEPWPENAALYQPLKEDQILLSDSASSLAVQTFLRM CGLPVQVSCRANAEYMSPSGKVPFIQVGNQVVSELGPIVQFTKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELY IQWCDDFTATEISRPRYSSPYSWPLNHILAYQKQWEVRRKMNAIGWSGKSLEQVYEDVSQCCQALSQRLGTQPYFFNK QPTELDALVFGHLFTILTTQLTSDELVEKVKSYSNLLSFCHRIEQAYFKEQEREGQSGSSRHSKGSLP" }, annot { { data ftable { { data prot { name { "metaxin 2" } }, location whole gi 47086881 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 47086881, location int { from 346, to 1170, strand plus, id gi 47086880 }, ext { type str "GeneOntology", data { } } } } } } }, seq { id { swissprot { name "TXDC_HUMAN", accession "Q9H3N1" }, gi 47117631 }, descr { title "Thioredoxin domain containing protein 1 precursor (Transmembrane Trx-related protein) (Thioredoxin-related transmembrane protein) (UNQ235/PRO268)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 280, seq-data ncbistdaa '0C010E1107110B01130E0B01130B130B0B0B1407010E1412 08071010110D131013091204050D1410050B0B050704140C09050616010E14030E01030F0D0B0F 0E05140511060105140705040B05130D09010A13041312050F0E070B11071006090912010B0E12 091608030A040705061010160F070E10120A0A0406090D060911040A05140A1109050E13111114 06070E0711130B0C11110C11010B060F0B110C1409101203080D16060905040B070B0E13140711 16121306010B01120B0611070B0B0B070B030C0906130104030B030E110A1010100E0F0E160E16 0E110A0A0B0B110511010F0E0B0A0A130505050F05010405050413110505050105110A0507120D 0A04060E0F0D0109100F10110B070E110B0112040A11'H } }, seq { id { other { accession "YP_044822", version 1 }, gi 50083312 }, descr { title "putative glutathione S-transferase [Acinetobacter sp. ADP1]", source { org { taxname "Acinetobacter sp. ADP1", common "Acinetobacter sp. ADP1", db { { db "taxon", tag id 62977 } } } } }, inst { repr raw, mol aa, length 204, seq-data ncbistdaa '0C0A13160704090F11070D03160A130A0B0B0B0D060B050B 0108051409080904130B0A01051208120E05060B0A0C0D0E0D010A090E13130F0B0504070F0B0B 0105110D01090B07160B010507120806090E110410160A0A010A0C1605140C0606050F16110805 0E03090113011006090F0A160F070C0E0501100B0505160F0A0B0F0E0A07080A130B01090B050F 010B04070808160B0B07050513110B010409110B160116120813010405070706040B0D0B160E0D 090F1014030F1009010D1101071613070C0D120F12120113'H } }, seq { id { swissprot { name "PDL3_HUMAN", accession "Q9H2J4" }, gi 50401164 }, descr { title "Phosducin-like protein 3 (Viral IAP-associated factor 1) (VIAF-1) (HTPHLP)", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 239, seq-data ncbistdaa '0C0F040E0D01041205140D04090B100A0A07090B0E0E0A05 110B0A050B050505010505050F10090B0F0F1113130A121605040C120B05050B05040805040506 0D05050405100109050C16101010100B0105140A01120A0B0A0D0A060705130B050911070A0416 130F0513120A010705070B1413090B080B160A0F07090E0B03010B090D0F080B11070B01100A06 0E04130A06090A010911121203090E0D160E04100D0B0E12090613160B050704090A010F060907 0E0B130607070C0D0B121004050B05140A0B1105110701090C12040B05050D0E0A0A0E09050413 0B0B111113101011130B0C0A1004110411050704'H } }, seq { id { swissprot { name "TXN4B_HUMAN", accession "Q9NX01" }, gi 51702156 }, descr { title "Thioredoxin-like protein 4B (Dim1-like protein).", sp { class standard, seqref { gi 45594297, gi 45594298, gi 7020665, gi 7020666, gi 48146596, gi 48146597, gi 16307115, gi 16307116 }, dbref { { db "HSSP", tag str "O14834" }, { db "Ensembl", tag str "ENSG00000140830" }, { db "Genew", tag str "HGNC:26041" }, { db "InterPro", tag str "IPR004123" }, { db "InterPro", tag str "IPR006663" }, { db "Pfam", tag str "PF02966" } }, keywords { "Cell cycle", "mRNA processing", "mRNA splicing", "Nuclear protein" }, created std { year 2004, month 10, day 25 }, sequpd std { year 2004, month 10, day 25 }, annotupd std { year 2005, month 5, day 1 } }, comment "[FUNCTION] Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.", comment "[SUBUNIT] Interacts with the U5-102 kDa protein subunit of the spliceosome.", comment "[SUBCELLULAR LOCATION] Nuclear.", comment "[SIMILARITY] Belongs to the DIM1 family.", create-date std { year 2004, month 10, day 25 }, update-date std { year 2005, month 5, day 1 }, source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } } }, molinfo { biomol peptide, completeness complete }, pub { pub { gen { serial-number 1 }, pmid 15161931, article { title { name "DLP, a novel Dim1 family protein implicated in pre-mRNA splicing and cell cycle progression." }, authors { names std { { name name { last "Sun", initials "X." } }, { name name { last "Zhang", initials "H." } }, { name name { last "Wang", initials "D." } }, { name name { last "Ma", initials "D." } }, { name name { last "Shen", initials "Y." } }, { name name { last "Shang", initials "Y." } } }, affil str "Department of Biochemistry and Molecular Biology, Peking University Health Science Center, 38 Xue Yuan Road, Beijing 100083, China." }, from journal { title { iso-jta "J. Biol. Chem.", ml-jta "J Biol Chem", issn "0021-9258", name "The Journal of biological chemistry." }, imp { date std { year 2004, month 7, day 30 }, volume "279", issue "31", pages "32839-32847", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2004, month 5, day 27, hour 5, minute 0 } }, { pubstatus medline, date std { year 2004, month 9, day 11, hour 5, minute 0 } }, { pubstatus aheadofprint, date std { year 2004, month 5, day 25 } } } } }, ids { pubmed 15161931, doi "10.1074/jbc.M402522200", pii "M402522200" } } }, comment "NUCLEOTIDE SEQUENCE, FUNCTION, AND SUBCELLULAR LOCATION." }, pub { pub { gen { serial-number 2 }, pmid 14702039, article { title { name "Complete sequencing and characterization of 21,243 full-length human cDNAs." }, authors { names std { { name name { last "Ota", initials "T." } }, { name name { last "Suzuki", initials "Y." } }, { name name { last "Nishikawa", initials "T." } }, { name name { last "Otsuki", initials "T." } }, { name name { last "Sugiyama", initials "T." } }, { name name { last "Irie", initials "R." } }, { name name { last "Wakamatsu", initials "A." } }, { name name { last "Hayashi", initials "K." } }, { name name { last "Sato", initials "H." } }, { name name { last "Nagai", initials "K." } }, { name name { last "Kimura", initials "K." } }, { name name { last "Makita", initials "H." } }, { name name { last "Sekine", initials "M." } }, { name name { last "Obayashi", initials "M." } }, { name name { last "Nishi", initials "T." } }, { name name { last "Shibahara", initials "T." } }, { name name { last "Tanaka", initials "T." } }, { name name { last "Ishii", initials "S." } }, { name name { last "Yamamoto", initials "J." } }, { name name { last "Saito", initials "K." } }, { name name { last "Kawai", initials "Y." } }, { name name { last "Isono", initials "Y." } }, { name name { last "Nakamura", initials "Y." } }, { name name { last "Nagahari", initials "K." } }, { name name { last "Murakami", initials "K." } }, { name name { last "Yasuda", initials "T." } }, { name name { last "Iwayanagi", initials "T." } }, { name name { last "Wagatsuma", initials "M." } }, { name name { last "Shiratori", initials "A." } }, { name name { last "Sudo", initials "H." } }, { name name { last "Hosoiri", initials "T." } }, { name name { last "Kaku", initials "Y." } }, { name name { last "Kodaira", initials "H." } }, { name name { last "Kondo", initials "H." } }, { name name { last "Sugawara", initials "M." } }, { name name { last "Takahashi", initials "M." } }, { name name { last "Kanda", initials "K." } }, { name name { last "Yokoi", initials "T." } }, { name name { last "Furuya", initials "T." } }, { name name { last "Kikkawa", initials "E." } }, { name name { last "Omura", initials "Y." } }, { name name { last "Abe", initials "K." } }, { name name { last "Kamihara", initials "K." } }, { name name { last "Katsuta", initials "N." } }, { name name { last "Sato", initials "K." } }, { name name { last "Tanikawa", initials "M." } }, { name name { last "Yamazaki", initials "M." } }, { name name { last "Ninomiya", initials "K." } }, { name name { last "Ishibashi", initials "T." } }, { name name { last "Yamashita", initials "H." } }, { name name { last "Murakawa", initials "K." } }, { name name { last "Fujimori", initials "K." } }, { name name { last "Tanai", initials "H." } }, { name name { last "Kimata", initials "M." } }, { name name { last "Watanabe", initials "M." } }, { name name { last "Hiraoka", initials "S." } }, { name name { last "Chiba", initials "Y." } }, { name name { last "Ishida", initials "S." } }, { name name { last "Ono", initials "Y." } }, { name name { last "Takiguchi", initials "S." } }, { name name { last "Watanabe", initials "S." } }, { name name { last "Yosida", initials "M." } }, { name name { last "Hotuta", initials "T." } }, { name name { last "Kusano", initials "J." } }, { name name { last "Kanehori", initials "K." } }, { name name { last "Takahashi-Fujii", initials "A." } }, { name name { last "Hara", initials "H." } }, { name name { last "Tanase", initials "T.O." } }, { name name { last "Nomura", initials "Y." } }, { name name { last "Togiya", initials "S." } }, { name name { last "Komai", initials "F." } }, { name name { last "Hara", initials "R." } }, { name name { last "Takeuchi", initials "K." } }, { name name { last "Arita", initials "M." } }, { name name { last "Imose", initials "N." } }, { name name { last "Musashino", initials "K." } }, { name name { last "Yuuki", initials "H." } }, { name name { last "Oshima", initials "A." } }, { name name { last "Sasaki", initials "N." } }, { name name { last "Aotsuka", initials "S." } }, { name name { last "Yoshikawa", initials "Y." } }, { name name { last "Matsunawa", initials "H." } }, { name name { last "Ichihara", initials "T." } }, { name name { last "Shiohata", initials "N." } }, { name name { last "Sano", initials "S." } }, { name name { last "Moriya", initials "S." } }, { name name { last "Momiyama", initials "H." } }, { name name { last "Satoh", initials "N." } }, { name name { last "Takami", initials "S." } }, { name name { last "Terashima", initials "Y." } }, { name name { last "Suzuki", initials "O." } }, { name name { last "Nakagawa", initials "S." } }, { name name { last "Senoh", initials "A." } }, { name name { last "Mizoguchi", initials "H." } }, { name name { last "Goto", initials "Y." } }, { name name { last "Shimizu", initials "F." } }, { name name { last "Wakebe", initials "H." } }, { name name { last "Hishigaki", initials "H." } }, { name name { last "Watanabe", initials "T." } }, { name name { last "Sugiyama", initials "A." } }, { name name { last "Takemoto", initials "M." } }, { name name { last "Kawakami", initials "B." } }, { name name { last "Yamazaki", initials "M." } }, { name name { last "Watanabe", initials "K." } }, { name name { last "Kumagai", initials "A." } }, { name name { last "Itakura", initials "S." } }, { name name { last "Fukuzumi", initials "Y." } }, { name name { last "Fujimori", initials "Y." } }, { name name { last "Komiyama", initials "M." } }, { name name { last "Tashiro", initials "H." } }, { name name { last "Tanigami", initials "A." } }, { name name { last "Fujiwara", initials "T." } }, { name name { last "Ono", initials "T." } }, { name name { last "Yamada", initials "K." } }, { name name { last "Fujii", initials "Y." } }, { name name { last "Ozaki", initials "K." } }, { name name { last "Hirao", initials "M." } }, { name name { last "Ohmori", initials "Y." } }, { name name { last "Kawabata", initials "A." } }, { name name { last "Hikiji", initials "T." } }, { name name { last "Kobatake", initials "N." } }, { name name { last "Inagaki", initials "H." } }, { name name { last "Ikema", initials "Y." } }, { name name { last "Okamoto", initials "S." } }, { name name { last "Okitani", initials "R." } }, { name name { last "Kawakami", initials "T." } }, { name name { last "Noguchi", initials "S." } }, { name name { last "Itoh", initials "T." } }, { name name { last "Shigeta", initials "K." } }, { name name { last "Senba", initials "T." } }, { name name { last "Matsumura", initials "K." } }, { name name { last "Nakajima", initials "Y." } }, { name name { last "Mizuno", initials "T." } }, { name name { last "Morinaga", initials "M." } }, { name name { last "Sasaki", initials "M." } }, { name name { last "Togashi", initials "T." } }, { name name { last "Oyama", initials "M." } }, { name name { last "Hata", initials "H." } }, { name name { last "Watanabe", initials "M." } }, { name name { last "Komatsu", initials "T." } }, { name name { last "Mizushima-Sugano", initials "J." } }, { name name { last "Satoh", initials "T." } }, { name name { last "Shirai", initials "Y." } }, { name name { last "Takahashi", initials "Y." } }, { name name { last "Nakagawa", initials "K." } }, { name name { last "Okumura", initials "K." } }, { name name { last "Nagase", initials "T." } }, { name name { last "Nomura", initials "N." } }, { name name { last "Kikuchi", initials "H." } }, { name name { last "Masuho", initials "Y." } }, { name name { last "Yamashita", initials "R." } }, { name name { last "Nakai", initials "K." } }, { name name { last "Yada", initials "T." } }, { name name { last "Nakamura", initials "Y." } }, { name name { last "Ohara", initials "O." } }, { name name { last "Isogai", initials "T." } }, { name name { last "Sugano", initials "S." } } }, affil str "Helix Research Institute, 1532-3 Yana, Kisarazu, Chiba 292-0812, Japan." }, from journal { title { iso-jta "Nat. Genet.", ml-jta "Nat Genet", issn "1061-4036", name "Nature genetics." }, imp { date std { year 2004, month 1 }, volume "36", issue "1", pages "40-45", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2004, month 1, day 1, hour 5, minute 0 } }, { pubstatus medline, date std { year 2004, month 2, day 3, hour 5, minute 0 } }, { pubstatus received, date std { year 2003, month 10, day 7 } }, { pubstatus accepted, date std { year 2003, month 12, day 1 } }, { pubstatus aheadofprint, date std { year 2003, month 12, day 21 } } } } }, ids { pubmed 14702039, doi "10.1038/ng1285", pii "ng1285" } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]." }, pub { pub { gen { serial-number 3 }, sub { authors { names std { { name name { last "Ebert", initials "L." } }, { name name { last "Schick", initials "M." } }, { name name { last "Neubert", initials "P." } }, { name name { last "Schatten", initials "R." } }, { name name { last "Henze", initials "S." } }, { name name { last "Korn", initials "B." } } }, affil str "to the EMBL/GenBank/DDBJ databases" }, medium other, date std { year 2004, month 6 } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]." }, pub { pub { gen { serial-number 4 }, pmid 12477932, article { title { name "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." }, authors { names std { { name name { last "Strausberg", initials "R.L." } }, { name name { last "Feingold", initials "E.A." } }, { name name { last "Grouse", initials "L.H." } }, { name name { last "Derge", initials "J.G." } }, { name name { last "Klausner", initials "R.D." } }, { name name { last "Collins", initials "F.S." } }, { name name { last "Wagner", initials "L." } }, { name name { last "Shenmen", initials "C.M." } }, { name name { last "Schuler", initials "G.D." } }, { name name { last "Altschul", initials "S.F." } }, { name name { last "Zeeberg", initials "B." } }, { name name { last "Buetow", initials "K.H." } }, { name name { last "Schaefer", initials "C.F." } }, { name name { last "Bhat", initials "N.K." } }, { name name { last "Hopkins", initials "R.F." } }, { name name { last "Jordan", initials "H." } }, { name name { last "Moore", initials "T." } }, { name name { last "Max", initials "S.I." } }, { name name { last "Wang", initials "J." } }, { name name { last "Hsieh", initials "F." } }, { name name { last "Diatchenko", initials "L." } }, { name name { last "Marusina", initials "K." } }, { name name { last "Farmer", initials "A.A." } }, { name name { last "Rubin", initials "G.M." } }, { name name { last "Hong", initials "L." } }, { name name { last "Stapleton", initials "M." } }, { name name { last "Soares", initials "M.B." } }, { name name { last "Bonaldo", initials "M.F." } }, { name name { last "Casavant", initials "T.L." } }, { name name { last "Scheetz", initials "T.E." } }, { name name { last "Brownstein", initials "M.J." } }, { name name { last "Usdin", initials "T.B." } }, { name name { last "Toshiyuki", initials "S." } }, { name name { last "Carninci", initials "P." } }, { name name { last "Prange", initials "C." } }, { name name { last "Raha", initials "S.S." } }, { name name { last "Loquellano", initials "N.A." } }, { name name { last "Peters", initials "G.J." } }, { name name { last "Abramson", initials "R.D." } }, { name name { last "Mullahy", initials "S.J." } }, { name name { last "Bosak", initials "S.A." } }, { name name { last "McEwan", initials "P.J." } }, { name name { last "McKernan", initials "K.J." } }, { name name { last "Malek", initials "J.A." } }, { name name { last "Gunaratne", initials "P.H." } }, { name name { last "Richards", initials "S." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Hale", initials "S." } }, { name name { last "Garcia", initials "A.M." } }, { name name { last "Gay", initials "L.J." } }, { name name { last "Hulyk", initials "S.W." } }, { name name { last "Villalon", initials "D.K." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Sodergren", initials "E.J." } }, { name name { last "Lu", initials "X." } }, { name name { last "Gibbs", initials "R.A." } }, { name name { last "Fahey", initials "J." } }, { name name { last "Helton", initials "E." } }, { name name { last "Ketteman", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Rodrigues", initials "S." } }, { name name { last "Sanchez", initials "A." } }, { name name { last "Whiting", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Young", initials "A.C." } }, { name name { last "Shevchenko", initials "Y." } }, { name name { last "Bouffard", initials "G.G." } }, { name name { last "Blakesley", initials "R.W." } }, { name name { last "Touchman", initials "J.W." } }, { name name { last "Green", initials "E.D." } }, { name name { last "Dickson", initials "M.C." } }, { name name { last "Rodriguez", initials "A.C." } }, { name name { last "Grimwood", initials "J." } }, { name name { last "Schmutz", initials "J." } }, { name name { last "Myers", initials "R.M." } }, { name name { last "Butterfield", initials "Y.S." } }, { name name { last "Krzywinski", initials "M.I." } }, { name name { last "Skalska", initials "U." } }, { name name { last "Smailus", initials "D.E." } }, { name name { last "Schnerch", initials "A." } }, { name name { last "Schein", initials "J.E." } }, { name name { last "Jones", initials "S.J." } }, { name name { last "Marra", initials "M.A." } }, { name consortium "Mammalian Gene Collection Program Team" } }, affil str "National Cancer Institute, Bethessda, MD 20892-2580, USA. rls@nih.gov" }, from journal { title { iso-jta "Proc. Natl. Acad. Sci. U.S.A.", ml-jta "Proc Natl Acad Sci U S A", issn "0027-8424", name "Proceedings of the National Academy of Sciences of the United States of America." }, imp { date std { year 2002, month 12, day 24 }, volume "99", issue "26", pages "16899-16903", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2002, month 12, day 13, hour 4, minute 0 } }, { pubstatus medline, date std { year 2003, month 1, day 22, hour 4, minute 0 } }, { pubstatus aheadofprint, date std { year 2002, month 12, day 11 } } } } }, ids { pubmed 12477932, doi "10.1073/pnas.242603899", pii "242603899" } } }, comment "NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].~TISSUE=Cervix" } }, inst { repr raw, mol aa, length 149, seq-data ncbieaa "MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSS DLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKL IVQSPIDPKNIPKYDLLYQDI" }, annot { { data ftable { { data gene { locus "TXNL4B", syn { "DIM2", "DLP;" } }, location int { from 0, to 148, id gi 51702156 } }, { data prot { name { "Thioredoxin-like protein 4B" } }, location int { from 0, to 148, id gi 51702156 } } } } } }, seq { id { other { accession "NP_056998", version 4 }, gi 54633317 }, descr { molinfo { biomol peptide }, title "thioredoxin domain containing 11 [Homo sapiens]", create-date std { year 2000, month 5, day 3 }, source { genome genomic, org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } }, orgname { name binomial { genus "Homo", species "sapiens" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae; Homo", gcode 1, mgcode 2, div "PRI" } }, subtype { { subtype chromosome, name "16" }, { subtype map, name "16p13.13" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Provisional" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "AK027646.1" }, { label str "gi", data int 14042477 } } } } }, { label str "Related", data fields { { label id 0, data fields { { label str "accession", data str "AF131780.1" }, { label str "gi", data int 4406607 } } }, { label id 0, data fields { { label str "accession", data str "AK027464.1" }, { label str "gi", data int 14042157 } } } } }, { label str "SpliceVar", data fields { { label id 0, data fields { { label str "accession", data str "BC002856.1" }, { label str "gi", data int 45708510 } } } } } } }, pub { pub { pmid 14702039, article { title { name "Complete sequencing and characterization of 21,243 full-length human cDNAs." }, authors { names std { { name name { last "Ota", initials "T." } }, { name name { last "Suzuki", initials "Y." } }, { name name { last "Nishikawa", initials "T." } }, { name name { last "Otsuki", initials "T." } }, { name name { last "Sugiyama", initials "T." } }, { name name { last "Irie", initials "R." } }, { name name { last "Wakamatsu", initials "A." } }, { name name { last "Hayashi", initials "K." } }, { name name { last "Sato", initials "H." } }, { name name { last "Nagai", initials "K." } }, { name name { last "Kimura", initials "K." } }, { name name { last "Makita", initials "H." } }, { name name { last "Sekine", initials "M." } }, { name name { last "Obayashi", initials "M." } }, { name name { last "Nishi", initials "T." } }, { name name { last "Shibahara", initials "T." } }, { name name { last "Tanaka", initials "T." } }, { name name { last "Ishii", initials "S." } }, { name name { last "Yamamoto", initials "J." } }, { name name { last "Saito", initials "K." } }, { name name { last "Kawai", initials "Y." } }, { name name { last "Isono", initials "Y." } }, { name name { last "Nakamura", initials "Y." } }, { name name { last "Nagahari", initials "K." } }, { name name { last "Murakami", initials "K." } }, { name name { last "Yasuda", initials "T." } }, { name name { last "Iwayanagi", initials "T." } }, { name name { last "Wagatsuma", initials "M." } }, { name name { last "Shiratori", initials "A." } }, { name name { last "Sudo", initials "H." } }, { name name { last "Hosoiri", initials "T." } }, { name name { last "Kaku", initials "Y." } }, { name name { last "Kodaira", initials "H." } }, { name name { last "Kondo", initials "H." } }, { name name { last "Sugawara", initials "M." } }, { name name { last "Takahashi", initials "M." } }, { name name { last "Kanda", initials "K." } }, { name name { last "Yokoi", initials "T." } }, { name name { last "Furuya", initials "T." } }, { name name { last "Kikkawa", initials "E." } }, { name name { last "Omura", initials "Y." } }, { name name { last "Abe", initials "K." } }, { name name { last "Kamihara", initials "K." } }, { name name { last "Katsuta", initials "N." } }, { name name { last "Sato", initials "K." } }, { name name { last "Tanikawa", initials "M." } }, { name name { last "Yamazaki", initials "M." } }, { name name { last "Ninomiya", initials "K." } }, { name name { last "Ishibashi", initials "T." } }, { name name { last "Yamashita", initials "H." } }, { name name { last "Murakawa", initials "K." } }, { name name { last "Fujimori", initials "K." } }, { name name { last "Tanai", initials "H." } }, { name name { last "Kimata", initials "M." } }, { name name { last "Watanabe", initials "M." } }, { name name { last "Hiraoka", initials "S." } }, { name name { last "Chiba", initials "Y." } }, { name name { last "Ishida", initials "S." } }, { name name { last "Ono", initials "Y." } }, { name name { last "Takiguchi", initials "S." } }, { name name { last "Watanabe", initials "S." } }, { name name { last "Yosida", initials "M." } }, { name name { last "Hotuta", initials "T." } }, { name name { last "Kusano", initials "J." } }, { name name { last "Kanehori", initials "K." } }, { name name { last "Takahashi-Fujii", initials "A." } }, { name name { last "Hara", initials "H." } }, { name name { last "Tanase", initials "T.O." } }, { name name { last "Nomura", initials "Y." } }, { name name { last "Togiya", initials "S." } }, { name name { last "Komai", initials "F." } }, { name name { last "Hara", initials "R." } }, { name name { last "Takeuchi", initials "K." } }, { name name { last "Arita", initials "M." } }, { name name { last "Imose", initials "N." } }, { name name { last "Musashino", initials "K." } }, { name name { last "Yuuki", initials "H." } }, { name name { last "Oshima", initials "A." } }, { name name { last "Sasaki", initials "N." } }, { name name { last "Aotsuka", initials "S." } }, { name name { last "Yoshikawa", initials "Y." } }, { name name { last "Matsunawa", initials "H." } }, { name name { last "Ichihara", initials "T." } }, { name name { last "Shiohata", initials "N." } }, { name name { last "Sano", initials "S." } }, { name name { last "Moriya", initials "S." } }, { name name { last "Momiyama", initials "H." } }, { name name { last "Satoh", initials "N." } }, { name name { last "Takami", initials "S." } }, { name name { last "Terashima", initials "Y." } }, { name name { last "Suzuki", initials "O." } }, { name name { last "Nakagawa", initials "S." } }, { name name { last "Senoh", initials "A." } }, { name name { last "Mizoguchi", initials "H." } }, { name name { last "Goto", initials "Y." } }, { name name { last "Shimizu", initials "F." } }, { name name { last "Wakebe", initials "H." } }, { name name { last "Hishigaki", initials "H." } }, { name name { last "Watanabe", initials "T." } }, { name name { last "Sugiyama", initials "A." } }, { name name { last "Takemoto", initials "M." } }, { name name { last "Kawakami", initials "B." } }, { name name { last "Yamazaki", initials "M." } }, { name name { last "Watanabe", initials "K." } }, { name name { last "Kumagai", initials "A." } }, { name name { last "Itakura", initials "S." } }, { name name { last "Fukuzumi", initials "Y." } }, { name name { last "Fujimori", initials "Y." } }, { name name { last "Komiyama", initials "M." } }, { name name { last "Tashiro", initials "H." } }, { name name { last "Tanigami", initials "A." } }, { name name { last "Fujiwara", initials "T." } }, { name name { last "Ono", initials "T." } }, { name name { last "Yamada", initials "K." } }, { name name { last "Fujii", initials "Y." } }, { name name { last "Ozaki", initials "K." } }, { name name { last "Hirao", initials "M." } }, { name name { last "Ohmori", initials "Y." } }, { name name { last "Kawabata", initials "A." } }, { name name { last "Hikiji", initials "T." } }, { name name { last "Kobatake", initials "N." } }, { name name { last "Inagaki", initials "H." } }, { name name { last "Ikema", initials "Y." } }, { name name { last "Okamoto", initials "S." } }, { name name { last "Okitani", initials "R." } }, { name name { last "Kawakami", initials "T." } }, { name name { last "Noguchi", initials "S." } }, { name name { last "Itoh", initials "T." } }, { name name { last "Shigeta", initials "K." } }, { name name { last "Senba", initials "T." } }, { name name { last "Matsumura", initials "K." } }, { name name { last "Nakajima", initials "Y." } }, { name name { last "Mizuno", initials "T." } }, { name name { last "Morinaga", initials "M." } }, { name name { last "Sasaki", initials "M." } }, { name name { last "Togashi", initials "T." } }, { name name { last "Oyama", initials "M." } }, { name name { last "Hata", initials "H." } }, { name name { last "Watanabe", initials "M." } }, { name name { last "Komatsu", initials "T." } }, { name name { last "Mizushima-Sugano", initials "J." } }, { name name { last "Satoh", initials "T." } }, { name name { last "Shirai", initials "Y." } }, { name name { last "Takahashi", initials "Y." } }, { name name { last "Nakagawa", initials "K." } }, { name name { last "Okumura", initials "K." } }, { name name { last "Nagase", initials "T." } }, { name name { last "Nomura", initials "N." } }, { name name { last "Kikuchi", initials "H." } }, { name name { last "Masuho", initials "Y." } }, { name name { last "Yamashita", initials "R." } }, { name name { last "Nakai", initials "K." } }, { name name { last "Yada", initials "T." } }, { name name { last "Nakamura", initials "Y." } }, { name name { last "Ohara", initials "O." } }, { name name { last "Isogai", initials "T." } }, { name name { last "Sugano", initials "S." } } }, affil str "Helix Research Institute, 1532-3 Yana, Kisarazu, Chiba 292-0812, Japan." }, from journal { title { iso-jta "Nat. Genet.", issn "1061-4036" }, imp { date std { year 2004, month 1 }, volume "36", issue "1", pages "40-45", language "eng", pubstatus ppublish, history { { pubstatus aheadofprint, date std { year 2003, month 12, day 21 } }, { pubstatus accepted, date std { year 2003, month 12, day 1 } }, { pubstatus received, date std { year 2003, month 10, day 7 } }, { pubstatus medline, date std { year 2004, month 2, day 3, hour 5, minute 0 } }, { pubstatus pubmed, date std { year 2004, month 1, day 1, hour 5, minute 0 } } } } }, ids { pii "ng1285", doi "10.1038/ng1285", pubmed 14702039 } } }, reftype no-target }, pub { pub { pmid 15561711, article { title { name "Identification of a Novel Partner of Duox: EFP1, A THIOREDOXIN-RELATED PROTEIN." }, authors { names std { { name name { last "Wang", initials "D." } }, { name name { last "De Deken", initials "X." } }, { name name { last "Milenkovic", initials "M." } }, { name name { last "Song", initials "Y." } }, { name name { last "Pirson", initials "I." } }, { name name { last "Dumont", initials "J.E." } }, { name name { last "Miot", initials "F." } } }, affil str "Institut de Recherche Interdisciplinaire, Universit" }, from journal { title { iso-jta "J. Biol. Chem.", issn "0021-9258" }, imp { date std { year 2005, month 1, day 28 }, volume "280", issue "4", pages "3096-3103", language "eng", pubstatus ppublish, history { { pubstatus medline, date std { year 2004, month 11, day 25, hour 9, minute 0 } }, { pubstatus pubmed, date std { year 2004, month 11, day 25, hour 9, minute 0 } }, { pubstatus aheadofprint, date std { year 2004, month 11, day 22 } } } } }, ids { doi "10.1074/jbc.M407709200", pii "M407709200", pubmed 15561711 } } } }, update-date std { year 2005, month 2, day 4 } }, inst { repr raw, mol aa, length 958, seq-data ncbieaa "MSECGGRGGGSSSSEDAEDEGGGGGGPAGSDCLSSSPTLATASSAGRLRR GLRGAFLMARQRPELLCGAVALGCALLLALKFTCSRAKDVIIPAKPPVSFFSLRSPVLDLFQGQLDYAEYVRRDSEVV LLFFYAPWCGQSIAARAEIEQAASRLSDQVLFVAINCWWNQGKCRKQKHFFYFPVIYLYHRSFGPIEYKGPMSAVYIE KFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGYFEFSGSPQPPGYLTFFTSALHSLKKDYLGTVRFGVITNKHLAKLV SLVHSGSVYLHRHFNTSLVFPREVLNYTAENICKWALENQETLFRWLRPHGGKSLLLNNELKKGPALFLFIPFNPLAE SHPLIDEITEVALEYNNCHGDQVVERLLQHLRRVDAPVLESLALEVPAQLPDPPTITASPCCNTVVLPQWHSFSRTHN VCELCVNQTSGGMKPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSNFLTSYSPFSYYTACCRTISRGVSG FIDSEQGVFEAPTVAFSSLEKKCEVDAPSSVPHIEENRYLFPEVDMTSTNFTGLSCRTNKTLNIYLLDSNLFWLYAER LGAPSSTQVKEFAAIVDVKEESHYILDPKQALMKLTLESFIQNFSVLYSPLKRHLIGSGSAQFPSQHLITEVTTDTFW EVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKY PEDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQSEAVLQRGHISHLEREIQKLRAEISSLQRAQVQVESQLSS ARRDEHRLRQQQRALEEQHSLLHAHSEQLQALYEQKTRELQELARKLQELADASENLLTENTWLKILVATMERKLEGR DGAESLAAQREVHPKQPEPSATPQLPGSSPPPANVSATLVSERNKENRTD", hist { replaces { date std { year 2004, month 10, day 26 }, ids { gi 46048179 } } } }, annot { { data ftable { { data prot { name { "thioredoxin domain containing 11", "EF-hand binding protein 1" } }, location whole gi 54633317 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 54633317, location int { from 62, to 2938, id gi 54633316 }, ext { type str "GeneOntology", data { { label str "Function", data fields { { label id 0, data fields { { label str "text string", data str "isomerase activity" }, { label str "go id", data str "0016853" }, { label str "evidence", data str "IEA" } } }, { label id 0, data fields { { label str "text string", data str "electron transporter activity" }, { label str "go id", data str "0005489" }, { label str "evidence", data str "IEA" } } } } }, { label str "Process", data fields { { label id 0, data fields { { label str "text string", data str "electron transport" }, { label str "go id", data str "0006118" }, { label str "evidence", data str "IEA" } } } } } } } } } } } }, seq { id { other { accession "NP_001007281", version 1 }, gi 55926090 }, descr { molinfo { biomol peptide }, title "metaxin 1 [Danio rerio]", create-date std { year 2004, month 11, day 22 }, source { genome genomic, org { taxname "Danio rerio", common "zebrafish", db { { db "taxon", tag id 7955 } }, orgname { name binomial { genus "Danio", species "rerio" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio", gcode 1, mgcode 2, div "VRT" } } }, user { type str "RefGeneTracking", data { { label str "Status", data str "Provisional" }, { label str "Assembly", data fields { { label id 0, data fields { { label str "accession", data str "BC085411.1" }, { label str "gi", data int 55716085 } } } } }, { label str "Related", data fields { { label id 0, data fields { { label str "accession", data str "AY351958.1" }, { label str "gi", data int 38017355 } } } } } } }, pub { pub { pmid 12477932, article { title { name "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." }, authors { names std { { name name { last "Strausberg", initials "R.L." } }, { name name { last "Feingold", initials "E.A." } }, { name name { last "Grouse", initials "L.H." } }, { name name { last "Derge", initials "J.G." } }, { name name { last "Klausner", initials "R.D." } }, { name name { last "Collins", initials "F.S." } }, { name name { last "Wagner", initials "L." } }, { name name { last "Shenmen", initials "C.M." } }, { name name { last "Schuler", initials "G.D." } }, { name name { last "Altschul", initials "S.F." } }, { name name { last "Zeeberg", initials "B." } }, { name name { last "Buetow", initials "K.H." } }, { name name { last "Schaefer", initials "C.F." } }, { name name { last "Bhat", initials "N.K." } }, { name name { last "Hopkins", initials "R.F." } }, { name name { last "Jordan", initials "H." } }, { name name { last "Moore", initials "T." } }, { name name { last "Max", initials "S.I." } }, { name name { last "Wang", initials "J." } }, { name name { last "Hsieh", initials "F." } }, { name name { last "Diatchenko", initials "L." } }, { name name { last "Marusina", initials "K." } }, { name name { last "Farmer", initials "A.A." } }, { name name { last "Rubin", initials "G.M." } }, { name name { last "Hong", initials "L." } }, { name name { last "Stapleton", initials "M." } }, { name name { last "Soares", initials "M.B." } }, { name name { last "Bonaldo", initials "M.F." } }, { name name { last "Casavant", initials "T.L." } }, { name name { last "Scheetz", initials "T.E." } }, { name name { last "Brownstein", initials "M.J." } }, { name name { last "Usdin", initials "T.B." } }, { name name { last "Toshiyuki", initials "S." } }, { name name { last "Carninci", initials "P." } }, { name name { last "Prange", initials "C." } }, { name name { last "Raha", initials "S.S." } }, { name name { last "Loquellano", initials "N.A." } }, { name name { last "Peters", initials "G.J." } }, { name name { last "Abramson", initials "R.D." } }, { name name { last "Mullahy", initials "S.J." } }, { name name { last "Bosak", initials "S.A." } }, { name name { last "McEwan", initials "P.J." } }, { name name { last "McKernan", initials "K.J." } }, { name name { last "Malek", initials "J.A." } }, { name name { last "Gunaratne", initials "P.H." } }, { name name { last "Richards", initials "S." } }, { name name { last "Worley", initials "K.C." } }, { name name { last "Hale", initials "S." } }, { name name { last "Garcia", initials "A.M." } }, { name name { last "Gay", initials "L.J." } }, { name name { last "Hulyk", initials "S.W." } }, { name name { last "Villalon", initials "D.K." } }, { name name { last "Muzny", initials "D.M." } }, { name name { last "Sodergren", initials "E.J." } }, { name name { last "Lu", initials "X." } }, { name name { last "Gibbs", initials "R.A." } }, { name name { last "Fahey", initials "J." } }, { name name { last "Helton", initials "E." } }, { name name { last "Ketteman", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Rodrigues", initials "S." } }, { name name { last "Sanchez", initials "A." } }, { name name { last "Whiting", initials "M." } }, { name name { last "Madan", initials "A." } }, { name name { last "Young", initials "A.C." } }, { name name { last "Shevchenko", initials "Y." } }, { name name { last "Bouffard", initials "G.G." } }, { name name { last "Blakesley", initials "R.W." } }, { name name { last "Touchman", initials "J.W." } }, { name name { last "Green", initials "E.D." } }, { name name { last "Dickson", initials "M.C." } }, { name name { last "Rodriguez", initials "A.C." } }, { name name { last "Grimwood", initials "J." } }, { name name { last "Schmutz", initials "J." } }, { name name { last "Myers", initials "R.M." } }, { name name { last "Butterfield", initials "Y.S." } }, { name name { last "Krzywinski", initials "M.I." } }, { name name { last "Skalska", initials "U." } }, { name name { last "Smailus", initials "D.E." } }, { name name { last "Schnerch", initials "A." } }, { name name { last "Schein", initials "J.E." } }, { name name { last "Jones", initials "S.J." } }, { name name { last "Marra", initials "M.A." } }, { name consortium "Mammalian Gene Collection Program Team" } }, affil str "National Cancer Institute, Bethessda, MD 20892-2580, USA. rls@nih.gov" }, from journal { title { iso-jta "Proc. Natl. Acad. Sci. U.S.A.", issn "0027-8424" }, imp { date std { year 2002, month 12, day 24 }, volume "99", issue "26", pages "16899-16903", language "eng", pubstatus ppublish, history { { pubstatus pubmed, date std { year 2002, month 12, day 13, hour 4, minute 0 } }, { pubstatus medline, date std { year 2003, month 1, day 22, hour 4, minute 0 } }, { pubstatus aheadofprint, date std { year 2002, month 12, day 11 } } } } }, ids { pubmed 12477932, doi "10.1073/pnas.242603899", pii "242603899" } } } }, update-date std { year 2005, month 4, day 23 } }, inst { repr raw, mol aa, length 317, seq-data ncbieaa "MAAPLELFCWKGDYGLPSVDVDCLAVLAYAKFAGAPLKVHKITNPWRSPT GSLPALKTREEGSISQPSKIIIHLRKQKYNADYDLSAKEGADTLAFVSLLEEKLLPALVYTLWIDSKNYVDVTRCWYA ENIPFPLNFLLPNRMHSQQLEKLRLVRGDPVLEPGEQLEKELYRDAFECMTLLSQRLGSQKFFFGDSPSSLDAYVFAH LAPLLKIKLPNGKLQQHLNSLNNLEQFCSNILLLYFPSDQREAPARKIHVQSDSSDFDNEPHMRRNQILSVLFAVGAM LGYAVLTGIITIKRERPQLKNSSHEDGDEEDED" }, annot { { data ftable { { data prot { name { "metaxin 1" } }, location whole gi 55926090 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, product whole gi 55926090, location int { from 14, to 967, strand plus, id gi 55926089 }, ext { type str "GeneOntology", data { { label str "Process", data fields { { label id 0, data fields { { label str "text string", data str "transport" }, { label str "go id", data str "0006810" }, { label str "evidence", data str "IEA" } } } } } } } } } } } }, seq { id { embl { accession "CAI12977", version 1 }, gi 55960250 }, descr { title "novel DnaJ domain-containing protein [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 655, seq-data ncbistdaa '0C0513100A0B110911140F060B09130B130B090B0F090B11 010B0406040E1610130B071311101201110F0104090A0A01160A0A0B01100514080E040A0D0A04 0E070105040A06090F09110A011605090B110D05050A10110D16040F1607040107050D0F07160F 0A0F0F0F0F100516100610080608050D061606040511060608060E060D1105101004110904050A 160B0B0806110816130D0513130E0411060A0A0E160B090A091211041403061103090809050E13 140A0513090F050B05050B07130709071313080107160510100B0108080B07010811120E11090B 0709090D070A09110606080D01131310050D0B100F061305110B0B0E070D0B13050A13120D0A0D 161310060B1107140F0F050D0A0E08130B0B06040F120E09130E0B0B160A0B12010601160A0416 0B11060716131613070B10071205050C121010160D090D0916010E120B0B13060A0508090D100E 010413090F0110070C0A0A0F09090404060912100D0A160B0B0101100B12110F0A0B0608050B03 0E130A101108100F100A160313130B0B12010512120A0B110A0E060501060B1106010B010D120F 041213100613081316110D100F0F05060104120B0B0E04110501060F070A11011311090B051010 0D120107101313160A120B05040E140907110511040A06090B0B07160B040F0B100A040E010B0B 11110501130B0E040B1204050B010E13060B0B101406161101110416091104031404110906080D 0D1410050C0C0E0B0B110B090611010B06090B0607121309130F01061104110D0405100511110E 0E050A0505010F050A12070A12050E1106120A050D11110A090E0A0A070613051312050B120413 121612110D0B13100B100E07080C0D13130B090B110D11120A12110B0B0F0A06010B0513161206 12070A09091014'H } }, seq { id { gi 56203088, embl { accession "CAI19992", version 1 } }, descr { title "OTTHUMP00000016889 [Homo sapiens]", source { org { taxname "Homo sapiens", common "human", db { { db "taxon", tag id 9606 } } } } }, inst { repr raw, mol aa, length 504, seq-data ncbistdaa '120A11070105100F0B1007050E0101010101010F07110701 0E0E01100E011310070F030E11111111111101010111111301010111111301010110010110010B 10010E0B110E101001010E010E110801070701070E0710070110110F0E10110C08140713070601 1111100E031313040B11140D0F110911060607141401071105050E061106160704090901060E0B 0F04160707090C01070B0711040E14140A0A120B160B120707010B0B01010101160B0B08050B0B 1309100A0F0F050904110A040109090B080F0601100E0D0D07130E110B110E06030B0A0C051216 0B100C01040B0E160F0D160607070A0B11010F070A0C0E140905160D08050A1311071205060909 04060B05050A0B07130D0B0D0A0D0B070E080510010911100113120A0C13050508061614120B01 16030F1413040D0B0D0512100A0C0B110B110707070E06110D0B0B10141313030809120A070913 0A10050C08070807090710061105050509160C0B0C050A040C10110B01070B0B07040A0A16090C 070E0A0B11120B040112130607080B010F010C14120B0E0712100E05100B090A0711050B090D0B 010C160305100910100A06140E051408080404040D1209160511050511110507110A1208120E0B 0B04061106161110120512060504050701050D11061110120E04120406120708110B0604110413 040C040416120408050F030A'H } }, seq { id { gi 67847852, other { accession "ZP_00502971", version 1 } }, descr { source { org { taxname "Polaromonas sp. JS666", common "Polaromonas sp. JS666", db { { db "taxon", tag id 296591 } } } }, title "Glutathione S-transferase, N-terminal [Polaromonas sp. JS666]" }, inst { repr raw, mol aa, length 230, seq-data ncbistdaa '0C120E011112010E0104100E0B0E130B1611061010030E16 010C1001100B010B131311070F1003050B100513130B10110A0E0E050C0B010111110A0712130E 130B130B0E07070513090405110B04090C0B14010B101008040E0F08140B120E051007120B0F04 0C0F130B0904070D040701060A100D0B0410160A160E0D10160B05050101050512010704050113 0601050108101201070101140B07100B050B0C0B050F0807030B0607010F01110B01040C010B0B 0E0613100F06010812040101140612010F0E140E100B0F01140B010706050111010B160F11130C 050A08010E141001011105'H } }, seq { id { embl { accession "CAG08268", version 1 }, gi 47222013 }, descr { title "unnamed protein product [Tetraodon nigroviridis]", molinfo { biomol peptide, completeness partial }, create-date std { year 2004, month 3, day 17 }, update-date std { year 2004, month 3, day 17 }, source { org { taxname "Tetraodon nigroviridis", db { { db "taxon", tag id 99883 } }, orgname { name binomial { genus "Tetraodon", species "nigroviridis" }, lineage "Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei; Acanthomorpha; Acanthopterygii; Percomorpha; Tetraodontiformes; Tetradontoidea; Tetraodontidae; Tetraodon", gcode 1, mgcode 2, div "VRT" } }, subtype { { subtype chromosome, name "2" }, { subtype other, name "Genoscope sequence ID : SCAF14997" } } } }, inst { repr raw, mol aa, length 508, seq-data ncbieaa "LKLWLLPALEAVKVSPLIEKVSDHKDFKKLLRTRTNVLVLYTKTATSGDS HLKLLSDVAQTVKGQGTIAWVNCGDSEGRKLCKKVKVDPGSKRGGAELLHYKDGTFHTEYNRPATFKSMVAFLKDPSG PPLWEENPEAKDVVHIETEKDFRKLLKREERPILMMFYAPWCGVCKRMQPIFQQAATETKGKYVLAGMNVHPAEFDGL KQEYNVKGYPTFCYFEKGKFLHHYENYGATAKDIADWMKNPQAPQPKTPEVPWSESGSSVFHLTDESFDGFLEEHPAV LVMFYAPWCGHCKKMKPEYDEAAEILNKGVDSPGVLAAVDATEHKAVGERFKISGFPSLKYFVNGEEKYTLSQLRSKD KIIEFMHNPQAPPPPEQSWEDRPSEVSHLGSEDFRDALKKKKHALVMFYAPWCPHCKSSIPHFTTAAEVFKEDRKIIY AAVDCTKGQNHELCKQEGVEGYPTFNHYNYGKFVEKYNGERGEEGFKGFMRSVRGRDQEKVGKRKEEL" }, annot { { data ftable { { data prot { desc "unnamed protein product" }, partial TRUE, location whole gi 47222013 } } }, { data ftable { { data cdregion { frame one, code { id 1 } }, partial TRUE, product whole gi 47222013, location mix { int { from 1111602, to 1111734, strand minus, id gi 47221940, fuzz-to lim gt }, int { from 1110069, to 1110156, strand minus, id gi 47221940 }, int { from 1107363, to 1107446, strand minus, id gi 47221940 }, int { from 1107238, to 1107283, strand minus, id gi 47221940 }, int { from 1106374, to 1106466, strand minus, id gi 47221940 }, int { from 1105677, to 1105737, strand minus, id gi 47221940 }, int { from 1105391, to 1105458, strand minus, id gi 47221940 }, int { from 1104040, to 1104131, strand minus, id gi 47221940 }, int { from 1101237, to 1101308, strand minus, id gi 47221940 }, int { from 1100211, to 1100347, strand minus, id gi 47221940 }, int { from 1096351, to 1096421, strand minus, id gi 47221940 }, int { from 1095583, to 1095746, strand minus, id gi 47221940 }, int { from 1095298, to 1095428, strand minus, id gi 47221940 }, int { from 1094094, to 1094164, strand minus, id gi 47221940 }, int { from 1091545, to 1091679, strand minus, id gi 47221940 }, int { from 1091310, to 1091387, strand minus, id gi 47221940, fuzz-from lim lt } } } } }, { db other, name "Annot:CDD", desc { name "CDDSearch", create-date std { year 2005, month 7, day 18 } }, data ftable { { data region "Thioredoxin", comment "Thioredoxin", location int { from 262, to 367, id gi 47222013 }, ext { type str "cddScoreData", data { { label str "definition", data str "pfam00085" }, { label str "short_name", data str "Thioredoxin" }, { label str "score", data int 238 }, { label str "evalue", data real { 122531, 10, -25 } }, { label str "bit_score", data real { 956757, 10, -4 } } } }, dbxref { { db "CDD", tag id 24359 } } }, { data region "Thioredoxin", comment "Thioredoxin", location int { from 138, to 244, id gi 47222013 }, ext { type str "cddScoreData", data { { label str "definition", data str "pfam00085" }, { label str "short_name", data str "Thioredoxin" }, { label str "score", data int 206 }, { label str "evalue", data real { 587097, 10, -22 } }, { label str "bit_score", data real { 833494, 10, -4 } } } }, dbxref { { db "CDD", tag id 24359 } } }, { data region "Thioredoxin", comment "Thioredoxin", location int { from 385, to 491, id gi 47222013 }, ext { type str "cddScoreData", data { { label str "definition", data str "pfam00085" }, { label str "short_name", data str "Thioredoxin" }, { label str "score", data int 192 }, { label str "evalue", data real { 282644, 10, -20 } }, { label str "bit_score", data real { 779566, 10, -4 } } } }, dbxref { { db "CDD", tag id 24359 } } } } } } }, seq { id { local str "consensus" }, inst { repr raw, mol aa, length 69, seq-data ncbieaa "LVLFYAPWCPFCQALRPVLAELALLNKGVKFEAVDVDEDPALEKELKRYG VGGVPTLVVFGPGIGVKYG" } } } }, distance { nelements 134, div-ranks { 0, 115, 87, 107, 119, 45, 132, 117, 39, 51, 31, 85, 112, 35, 17, 23, 15, 12, 65, 116, 18, 34, 27, 54, 50, 55, 58, 44, 59, 26, 22, 129, 48, 29, 14, 131, 123, 91, 56, 96, 63, 89, 20, 125, 68, 13, 47, 11, 9, 92, 25, 4, 101, 100, 79, 62, 80, 66, 33, 111, 106, 99, 98, 128, 7, 75, 6, 16, 114, 61, 110, 60, 93, 57, 5, 3, 121, 38, 21, 19, 82, 122, 78, 71, 69, 40, 53, 102, 43, 41, 37, 97, 72, 36, 64, 77, 90, 49, 81, 46, 120, 95, 84, 32, 70, 30, 28, 113, 83, 52, 130, 127, 42, 104, 24, 10, 103, 126, 8, 124, 133, 94, 73, 109, 105, 108, 67, 118, 88, 74, 76, 2, 86, 1 } }, master3d { pdb { mol "2TRX", chain 65 } }, alignannot { }, scoreparams { pssm { isProtein TRUE, numRows 26, numColumns 69, byRow FALSE, query seq { id { general { db "Cdd", tag str "cd01659" } }, descr { title "cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others.." }, inst { repr raw, mol aa, length 69, seq-data ncbieaa "LVLFYAPWCPFCQALRPVLAELALLNKGVKFEAVDVDEDPALEKELKRYG VGGVPTLVVFGPGIGVKYG" } }, finalData { scores { -32768, -245, -32768, -236, -813, -750, 104, -562, -723, 388, -711, 409, 394, -781, -336, -685, -715, -483, -551, 332, -642, -100, -31, -32768, -32768, -401, -32768, -177, -32768, -619, -321, -17, -20, -750, -284, 367, 24, 191, -173, -660, -693, -115, -222, -395, 93, 402, -702, -100, -288, -32768, -32768, -401, -32768, -334, -32768, -659, 64, 62, 197, -143, -25, 64, -255, 320, 24, -93, -716, -574, -257, -310, -386, 230, -110, -100, 222, -32768, -32768, -401, -32768, -488, -32768, 267, -779, -725, 718, -370, 94, -85, -711, -61, -480, -347, -419, -393, -705, -381, -233, -32, 71, -100, 564, -32768, -32768, -401, -32768, -193, -32768, -280, -115, -214, 295, 41, 428, -89, -593, -398, -236, -345, -704, -167, -184, -2, 79, 18, 471, -100, 541, -32768, -32768, -401, -32768, 255, -32768, -256, 173, -59, 108, -77, 152, -455, 126, -248, -63, -153, 78, -183, -108, 122, -56, -607, 121, -100, 32, -32768, -32768, -401, -32768, -210, -32768, -703, 264, -66, -142, -192, -578, -262, 93, -183, -598, 110, 410, 11, -136, 146, -58, -139, -23, -100, -70, -32768, -32768, -401, -32768, 64, -32768, -593, -11, 61, -212, -2, 128, -205, -51, -182, -64, -117, -375, -228, 84, -34, 57, -116, 807, -100, -133, -32768, -32768, -401, -32768, -286, -32768, 904, 177, -151, 94, -291, -18, -340, -334, -492, -173, -452, -211, -464, 53, 165, -213, -235, -533, -100, -298, -32768, -32768, -401, -32768, -131, -32768, -600, -66, -190, -75, 305, -19, -202, -338, -422, -236, -180, 562, -181, -152, 1, -128, -120, -204, -100, -563, -32768, -32768, -401, -32768, -141, -32768, -160, -116, -404, 303, -182, 474, -35, -222, -144, -547, 67, 156, -79, -99, -18, 101, -250, 336, -100, 293, -32768, -32768, -401, -32768, -31, -32768, 994, -360, -227, -648, -282, -654, -587, -316, -229, -265, -226, -438, -233, -426, 133, -234, -211, -683, -100, 27, -32768, -32768, -401, -32768, -19, -32768, -269, -196, -25, -240, -285, 278, -128, 217, -60, 119, -344, -102, 364, 211, -125, -154, -90, 156, -100, 35, -32768, -32768, -401, -32768, 219, -32768, -260, -223, -147, -34, -257, -8, -75, 294, -106, 61, -238, -345, 208, 248, 9, -144, -84, -711, -100, -343, -32768, -32768, -401, -32768, 5, -32768, 239, -269, -41, 201, -382, -652, 105, -420, 259, 367, -387, -248, -41, -160, -431, -24, 231, -651, -100, -147, -32768, -32768, -401, -32768, 63, -32768, -690, -240, 75, -220, -88, 155, -60, 202, 33, -23, 94, -653, 38, 316, -142, -62, -193, -191, -100, -69, -32768, -32768, -401, -32768, 66, -32768, -181, -100, 217, -669, -235, -589, -15, -11, -97, -32, -286, 434, 109, 15, -82, 17, -577, 138, -100, -127, -32768, -32768, -401, -32768, 129, -32768, -633, -75, 14, -105, -688, 141, 227, -83, 84, 62, -348, -360, -22, -22, -263, -105, 303, 3, -100, -28, -32768, -32768, -401, -32768, 185, -32768, -611, -434, -330, 301, -452, -670, 154, -675, 421, 289, -733, -723, -645, -687, -320, -402, -22, 345, -100, 64, -32768, -32768, -401, -32768, 118, -32768, 152, 160, 173, -8, -482, -126, -157, 168, -420, -582, 148, -634, 70, 229, 33, -90, -58, -172, -100, -260, -32768, -32768, -401, -32768, 133, -32768, -99, 170, 248, -164, -156, -112, -121, 144, -166, -111, 1, -288, 148, 57, -28, -128, -98, -327, -100, -305, -32768, -32768, -401, -32768, 10, -32768, -273, -105, 123, 53, -208, -51, 91, -181, 235, -59, 49, -132, -122, -95, -149, -174, 99, 29, -100, -6, -32768, -32768, -401, -32768, 142, -32768, -233, 8, 114, 54, -217, -80, -126, 208, -63, -212, -101, -108, -52, 12, 121, -16, -124, -15, -100, -129, -32768, -32768, -401, -32768, 81, -32768, -295, 105, 114, 102, -127, 10, -121, 171, 84, -251, -166, -204, 42, -74, -89, -76, -193, -277, -100, 183, -32768, -32768, -401, -32768, 102, -32768, -42, -82, 185, -179, -60, 73, -67, 38, 121, 171, -92, -29, -96, 63, -177, -293, -67, -67, -100, 5, -32768, -32768, -401, -32768, 16, -32768, -264, 140, 91, 123, -184, 69, -318, 170, -131, -103, 299, -174, 52, -147, 128, -219, -474, -669, -100, 124, -32768, -32768, -401, -32768, -82, -32768, -229, 214, 127, -198, 19, 128, -269, 272, 48, -182, -157, 164, -170, -95, 5, -85, -355, -100, -100, -624, -32768, -32768, -401, -32768, -119, -32768, -724, 241, -24, -338, 391, 54, -680, 57, -285, 14, 182, -235, 92, 56, -320, -17, -229, -745, -100, -326, -32768, -32768, -401, -32768, -218, -32768, -42, -484, -466, 300, -413, -295, 326, -419, 230, -94, -699, -723, -93, -421, -183, -32, 406, -147, -100, -65, -32768, -32768, -401, -32768, -11, -32768, -140, 104, 87, -702, -271, -96, -177, 179, -175, -203, -125, 120, 124, 159, 41, 88, 132, -767, -100, -654, -32768, -32768, -401, -32768, -417, -32768, 5, -804, -742, 576, -795, 77, 246, -723, 81, -81, -749, -452, -701, -722, -436, -355, 393, 236, -100, 342, -32768, -32768, -401, -32768, 142, -32768, -222, -235, 277, -111, 19, -103, 148, -60, -11, -493, -189, -662, -7, -280, -520, -118, 278, 172, -100, -136, -32768, -32768, -401, -32768, 176, -32768, -145, -85, 93, -145, -46, 147, 17, 162, 24, -139, -276, -254, -326, -26, -352, -51, 94, 329, -100, 58, -32768, -32768, -401, -32768, -44, -32768, 212, -461, -389, -3, -738, 259, 393, -183, 44, -22, -365, -708, -605, 16, -429, 14, 400, -40, -100, -106, -32768, -32768, -401, -32768, -341, -32768, -232, 440, -9, -11, -64, 213, -359, -180, -542, -654, 331, 143, -149, -164, 227, -165, -398, -92, -100, -345, -32768, -32768, -401, -32768, -107, -32768, 568, -122, -261, -156, -191, -96, 320, -371, -33, -237, -261, -97, -414, -257, -51, -8, 297, -169, -100, 34, -32768, -32768, -401, -32768, -194, -32768, -171, 424, 90, -437, 57, -584, -287, -100, -77, -94, 176, -41, -138, -240, 1, 191, -217, 20, -100, -323, -32768, -32768, -401, -32768, -15, -32768, -697, 147, 243, -110, 27, -77, -416, 118, -16, -13, 76, -79, 125, -147, -48, 11, -157, -183, -100, -194, -32768, -32768, -401, -32768, 54, -32768, -71, 217, 41, 92, -43, 115, -189, -211, -156, 22, 132, 12, 53, -26, -113, -60, 47, -681, -100, 54, -32768, -32768, -401, -32768, 96, -32768, 147, 67, 111, 144, 6, -129, -270, -118, -281, -559, 27, 309, -34, 11, 9, -36, -141, -180, -100, -351, -32768, -32768, -401, -32768, 98, -32768, -539, 226, 55, -183, 129, 112, -79, 132, -250, -138, 44, -4, -108, -80, -78, -28, -199, 216, -100, -134, -32768, -32768, -401, -32768, -192, -32768, -197, 6, 126, -1, -303, 236, 5, 102, 94, -25, -196, 37, 155, -143, 17, -74, 8, -84, -100, -10, -32768, -32768, -401, -32768, 87, -32768, 224, 26, 188, -122, -193, 122, -209, 89, -41, -45, -29, -60, 40, 167, -106, -40, -47, -468, -100, -417, -32768, -32768, -401, -32768, 18, -32768, -438, 153, 133, -182, -163, 99, -141, 193, -104, -41, 17, -37, 152, 177, -121, -73, -125, -105, -100, -235, -32768, -32768, -401, -32768, 31, -32768, 88, 71, 125, 149, -194, 141, -179, 1, -114, -3, -237, 13, -47, -113, 16, -4, 3, 396, -100, -20, -32768, -32768, -401, -32768, 88, -32768, -217, -87, -116, -31, 75, -210, -3, 104, 152, 143, -74, -202, 10, -6, -30, -142, -71, 173, -100, -203, -32768, -32768, -401, -32768, 112, -32768, 95, -149, -96, -195, -48, -275, 2, 249, -46, -107, -143, -278, 159, 148, -42, 84, -171, 40, -100, -68, -32768, -32768, -401, -32768, -17, -32768, -452, 32, 96, 10, -118, 166, -138, 161, -178, 128, -18, -241, 166, 210, -26, -44, -130, -16, -100, -41, -32768, -32768, -401, -32768, -259, -32768, -50, -28, -68, 195, -22, -176, -272, -87, 87, -12, 296, 75, -60, -282, -64, -306, -212, -94, -100, 446, -32768, -32768, -401, -32768, -204, -32768, -541, 71, -171, -516, 300, -223, -164, -44, -101, -2, 185, 286, 43, 69, -33, -280, -268, 76, -100, -51, -32768, -32768, -401, -32768, -95, -32768, -505, -137, -299, 118, 23, -77, 112, -98, 94, -226, -79, -79, -91, -184, -26, -59, 335, -92, -100, -101, -32768, -32768, -401, -32768, -91, -32768, -647, -12, 29, -28, 224, 67, 37, -55, -69, 98, -142, -81, -43, 219, -76, -84, -95, 142, -100, -139, -32768, -32768, -401, -32768, -30, -32768, 108, -83, -169, -602, 210, -40, -386, 189, -176, -84, -81, -414, 102, 115, 32, 133, -209, 128, -100, 235, -32768, -32768, -401, -32768, -59, -32768, -137, -374, -155, 135, -357, -589, 77, -118, 99, -106, -183, -265, -114, -101, -163, 25, 363, -63, -100, 350, -32768, -32768, -401, -32768, -556, -32768, -170, -199, -572, -345, -177, -671, -767, -334, -769, -722, -244, 845, -580, 13, -373, -580, -725, -837, -100, -749, -32768, -32768, -401, -32768, 254, -32768, -237, -232, -138, 79, -252, -228, -58, -253, -174, -7, -132, -632, 102, -207, -34, 391, 146, -165, -100, -184, -32768, -32768, -401, -32768, -429, -32768, -608, -762, -458, 345, -548, -720, 354, -395, 349, 181, -358, -738, -670, -694, -249, 19, 348, -640, -100, -494, -32768, -32768, -401, -32768, -158, -32768, -649, -419, 58, 368, -496, -598, 191, -72, 120, 188, -417, -707, 197, -600, -593, -252, 343, -589, -100, 211, -32768, -32768, -401, -32768, -224, -32768, -632, 109, -485, 289, -330, 55, 342, -263, 215, 10, -302, -381, -643, -679, -470, -226, 360, -47, -100, -21, -32768, -32768, -401, -32768, -463, -32768, -268, 137, -286, 485, 155, -58, 177, -617, -140, -96, 48, -156, -161, -175, -365, -314, 105, -551, -100, 335, -32768, -32768, -401, -32768, -297, -32768, -744, 331, -14, -215, 280, 113, -476, 199, -423, 1, 275, -155, 38, 89, -222, -146, -225, -769, -100, -652, -32768, -32768, -401, -32768, 23, -32768, -304, 177, -69, -143, 126, -268, -299, -24, -216, -15, 122, 293, -42, 127, -33, -84, -208, -301, -100, -31, -32768, -32768, -401, -32768, -111, -32768, -261, 235, -32, -78, 331, -233, -266, 59, -263, -250, -20, -75, 44, -12, 81, -2, -257, -259, -100, -250, -32768, -32768, -401, -32768, -90, -32768, -272, 6, 45, 12, 38, -42, 191, -5, 37, 66, -44, 78, -83, -74, -126, -61, 81, -37, -100, -252, -32768, -32768, -401, -32768, -130, -32768, -133, -135, -85, -75, 142, 72, -49, 178, -135, 52, -1, 97, 42, 157, -19, -158, 90, -368, -100, -336, -32768, -32768, -401, -32768, -25, -32768, -670, -138, 15, 31, -63, 190, 100, 33, -24, -58, -119, -672, 107, 122, -210, 14, 139, -633, -100, 253, -32768, -32768, -401, -32768, -49, -32768, -260, -26, -50, -50, -522, 22, 89, 180, 4, -192, -189, -126, -94, 144, -125, 128, 151, 334, -100, -47, -32768, -32768, -401, -32768, -450, -32768, -266, -488, -102, 300, -140, -94, 235, -249, 145, 207, -347, -371, -87, -110, -478, -274, 91, -168, -100, 562, -32768, -32768, -401, -32768, -6, -32768, -291, 31, -20, 132, 169, 59, -144, -178, -276, -185, 146, -82, -121, -252, 45, -16, 114, 217, -100, 158, -32768, -32768, -401 }, lambda { 267, 10, -3 }, kappa { 39572658585083, 10, -15 }, h { 14, 10, -2 }, scalingFactor 100 } }, params { pseudocount 5, rpsdbparams { matrixName "BLOSUM62" } } } }