IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the terminal oxygenase component of cumene dioxygenase from Pseudomonas fluorescens IP01. Crystal structure of the terminal oxygenase component of cumene dioxygenase from Pseudomonas fluorescens IP01. J. Bacteriol. (0021-9193) 2005 Dong X., Fushinobu S., Fukuda E., Terada T., Nakamura S., Shimizu K., Nojiri H., Omori T., Shoun H., Wakagi T. PDBe - Data obtained from the Protein Data Bank Europe in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dong X., Fushinobu S., Fukuda E., Terada T., Nakamura S., Shimizu K., Nojiri H., Omori T., Shoun H., Wakagi T. PDBe - Data obtained from the Protein Data Bank Europe J. Bacteriol. (0021-9193) 2005 q51743_psefl cumA1 protein protein psefl Pseudomonas fluorescens MSSIINKEVQEAPLKWVKNWSDEEIKALVDEEKGLLDPRIFSDQDLYEIELERVFARSWLLLGHEGHIPKAGDYLTTYMGEDPVIVVRQKDRSIKVFLNQCRHRGMRIERSDFGNAKSFTCTYHGWAYDTAGNLVNVPYEKEAFCDKKEGDCGFDKADWGPLQARVDTYKGLIFANWDTEAPDLKTYLSDATPYMDVMLDRTEAVTQVITGMQKTVIPCNWKFAAEQFCSDMYHAGTMAHLSGVLSSLPPEMDLSQVKLPSSGNQFRAKWGGHGTGWFNDDFALLQAIMGPKVVDYWTKGPAAERAKERLGKVLPADRMVAQHMTIFPTCSFLPGINTVRTWHPRGPNEIEVWSFIVVDADAPEDIKEEYRRKNIFTFNQGGTYEQDDGENWVEVQRGLRGYKARSRPLCAQMGAGVPNKNNPEFPGKTSYVYSEEAARGFYHHWSRMMSEPSWDTLKS BA940BD0092D26BA q51744_psefl cumA2 edoA2 protein protein psefl Pseudomonas fluorescens MTSADLTKPIEWPEMPVSLELQNAVEQFYYREAQLLDYQNYEAWLALLTQDIQYWMPIRTTHTSRNKAMEYVPPGGNAHFDETYESMRARIRARVSGLNWTEDPPSRSRHIVSNVIVRETESAGTLEVSSAFLCYRNRLERMTDIYVGERRDILLRVSDGLGFKIAKRTILLDQSTITANNLSQFF 914358D8648D4B0C cuma1-cuma2-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction hexameric, multimeric working 82.700%, free 80.400% 2.2A DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Molecular basis of messenger RNA recognition by the specific bacterial repressing clamp RsmA/CsrA. Molecular basis of messenger RNA recognition by the specific bacterial repressing clamp RsmA/CsrA. Nature structural & molecular biology 2007 imex curation Schubert M., Lapouge K., Duss O., Oberstrass FC., Jelesarov I., Haas D., Allain FH. Only protein-protein interactions ecolx Escherichia coli nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Schubert M., Lapouge K., Duss O., Oberstrass FC., Jelesarov I., Haas D., Allain FH. DIP original experiment: DIP-68092X Nature structural & molecular biology 2007 IMEx Molecular basis of messenger RNA recognition by the specific bacterial repressing clamp RsmA/CsrA. An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. Structure (London, England : 1993) 2005 imex curation Milani M., Leoni L., Rampioni G., Zennaro E., Ascenzi P., Bolognesi M. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Milani M., Leoni L., Rampioni G., Zennaro E., Ascenzi P., Bolognesi M. DIP original experiment: DIP-132836X Structure (London, England : 1993) 2005 IMEx An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. Structure (London, England : 1993) 2005 imex curation Milani M., Leoni L., Rampioni G., Zennaro E., Ascenzi P., Bolognesi M. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Milani M., Leoni L., Rampioni G., Zennaro E., Ascenzi P., Bolognesi M. DIP original experiment: DIP-132835X Structure (London, England : 1993) 2005 IMEx An active-like structure in the unphosphorylated StyR response regulator suggests a phosphorylation- dependent allosteric activation mechanism. o30989_psefl styR protein protein psefl Pseudomonas fluorescens MTAKPTVFVVDDDMSVREGLRNLLRSAGFEVETFDCASTFLEHRRPEQHGCLVLDMRMPGMSGIELQEQLTAISDGIPIVFITAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQLNAERRQARETQDQLEQLFSSLTGREQQVLQLTIRGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLVHLVEKYESFERGVS DIP protein O30989 original sequence version: 62 q5mxb2_psefl Translational regulator CsrA csrA1 Carbon storage regulator csrA PFL02_51630 csrA1_1 AO353_20785 NCTC10392_03803 NCTC3756_03536 PS691_02635 PS723_03584 protein protein psefl Pseudomonas fluorescens MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPDKRETP DIP protein Q5MXB2 original sequence version: 12 styr-1 3 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction styr-2 2 4 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rsme-1 1 5 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction