MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Self-trimerization of ExsD limits inhibition of the Pseudomonas aeruginosa transcriptional activator ExsA in vitro. Self-trimerization of ExsD limits inhibition of the Pseudomonas aeruginosa transcriptional activator ExsA in vitro. FEBS J. (1742-464X) 2013 Bernhards RC., Marsden AE., Esher SK., Yahr TL., Schubot FD. suggested by lperfetto in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Bernhards RC., Marsden AE., Esher SK., Yahr TL., Schubot FD. suggested by lperfetto FEBS J. (1742-464X) 2013 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FEBS Lett. (0014-5793) 2012 Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto FEBS Lett. (0014-5793) 2012 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FEBS Lett. (0014-5793) 2012 Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto FEBS Lett. (0014-5793) 2012 FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FolX from Pseudomonas aeruginosa is octameric in both crystal and solution. FEBS Lett. (0014-5793) 2012 Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Gabrielsen M., Beckham KS., Cogdell RJ., Byron O., Roe AJ. suggested by lperfetto FEBS Lett. (0014-5793) 2012 a0a0h2z989_pseab exsD PA14_42380 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MEQEDDKQYSREAVFAGRRVSVVGSDARSRGRVPGYASSSLYRESGIISARQLALLQRMLPRLRLEQLFRCEWLQQRLARGLALGREEVRQILLCAAQDDDGWCAELGDRVNLAVPQSMIDWVLLPVYGWWESLLDQAIPGWRLSLVELETQSRQLRIKSEFWSRVAELEPEQAREELARVAKCQARTQEQVAELAGKLETASALAKSAWPNWQRGMATLLASGGLAGFEPIPEVLECLWQPLCRLDDDVGAADAVQAWLHERNLCQAQDHFYWQS mint B63A868DF128C96D a0a0h2zeg5_pseab folX PA14_19620 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MPRLEPGMARIRVKDLRLRTFIGIKEEEILNKQDVLINLTILYPAADAVEVNDIEHALNYRTITKAIIRHVEENRFALLERMTQEILDLVMENPAVRYAEVEVDKPHALRFAESVSITLAGHR mint CAE3CBB1463D6436 folx-1 3 FolX 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction mint Here we report the crystal structure of FolX from the bacterial opportunistic pathogen Pseudomonas aeruginosa, as well as a detailed analysis of the protein in solution, using analytical ultracentrifugation (AUC) and small-angle X-ray scattering (SAXS). In combination, these techniques confirm that the protein is an octamer both in the crystal structure, and in solution. t1 f3 st2 PDB code: 4AEY folx-1 4 FolX 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction f4 mint Here we report the crystal structure of FolX from the bacterial opportunistic pathogen Pseudomonas aeruginosa, as well as a detailed analysis of the protein in solution, using analytical ultracentrifugation (AUC) and small-angle X-ray scattering (SAXS). In combination, these techniques confirm that the protein is an octamer both in the crystal structure, and in solution. folx-1 2 FolX 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 8.0 direct interaction direct interaction f5a mint Here we report the crystal structure of FolX from the bacterial opportunistic pathogen Pseudomonas aeruginosa, as well as a detailed analysis of the protein in solution, using analytical ultracentrifugation (AUC) and small-angle X-ray scattering (SAXS). In combination, these techniques confirm that the protein is an octamer both in the crystal structure, and in solution. exsd 1 ExsD 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified A0A0H2Z989:p.Met59Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Tue Jul 12 10:22:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:25:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met59arg' Tue Jun 30 18:25:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met59Arg' Stoichiometry: 3.0 direct interaction direct interaction f2b mint With the use of a calibration curve obtained by analyzing a set of standard proteins, we conducted an analytical gel filtration study to estimate the approximate molecular mass of the variant protein. The retention time of the variant protein gave an apparent molecular mass of 42 kDa. While this is somewhat larger than the actual 32 kDa mass of an ExsD monomer, the discrepancy is readily explained by the distinctively non-globular shape of the molecule [30]. In contrast, wild-type ExsD (Fig. 2B) eluted significantly earlier from the gel filtration column and gave an estimated molecular mass of 102 kDa, consistent with a homotrimeric complex as previously reported [30]. DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267065X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249578X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267059X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249577X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249586X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249584X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267054X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267062X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structure (London, England : 1993) 2013 imex curation Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255762X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267064X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249585X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249580X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267067X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267058X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249583X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249581X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267057X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249579X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structure (London, England : 1993) 2013 imex curation Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255761X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structure (London, England : 1993) 2013 imex curation Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Morris ER., Hall G., Li C., Heeb S., Kulkarni RV., Lovelock L., Silistre H., Messina M., Cámara M., Emsley J., Williams P., Searle MS. DIP original experiment: DIP-255763X Structure (London, England : 1993) 2013 IMEx Structural rearrangement in an RsmA/CsrA ortholog of Pseudomonas aeruginosa creates a dimeric RNA-binding protein, RsmN. Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Structure (London, England : 1993) 2009 imex curation Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. DIP original experiment: DIP-132060X Structure (London, England : 1993) 2009 IMEx Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267068X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267063X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by staining molecular weight estimation by staining weight by staining Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267061X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Structure (London, England : 1993) 2009 imex curation Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wiedenheft B., Zhou K., Jinek M., Coyle SM., Ma W., Doudna JA. DIP original experiment: DIP-132061X Structure (London, England : 1993) 2009 IMEx Structural basis for DNase activity of a conserved protein implicated in CRISPR-mediated genome defense. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267055X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Proceedings of the National Academy of Sciences of the United States of America 2011 imex curation Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. Only protein-protein interactions ecolx Escherichia coli pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wiedenheft B., van Duijn E., Bultema JB., Waghmare SP., Zhou K., Barendregt A., Westphal W., Heck AJ., Boekema EJ., Dickman MJ., Doudna JA. DIP original experiment: DIP-249582X Proceedings of the National Academy of Sciences of the United States of America 2011 IMEx RNA-guided complex from a bacterial immune system enhances target recognition through seed sequence interactions. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight silver stain molecular weight estimation by silver staining weight silver stain Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267060X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267056X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. Nature 2015 imex curation Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Bondy-Denomy J., Garcia B., Strum S., Du M., Rollins MF., Hidalgo-Reyes Y., Wiedenheft B., Maxwell KL., Davidson AR. DIP original experiment: DIP-267066X Nature 2015 IMEx Multiple mechanisms for CRISPR-Cas inhibition by anti-CRISPR proteins. csy1_pseab CRISPR-associated protein Csy1 csy1 PA14_33330 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MTSPLPTPTWQELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAEQAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFEHDFGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD DIP protein Q02ML9 original sequence version: 28 DIP protein Q02ML9 original sequence version: 44 cas3_pseab CRISPR-associated nuclease/helicase Cas3 subtype I-F/YPEST cas3 PA14_33340 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MNILLVSQCEKRALSETRRILDQFAERRGERTWQTPITQAGLDTLRRLLKKSARRNTAVACHWIRGRDHSELLWIVGDASRFNAQGAVPTNRTCRDILRKEDENDWHSAEDIRLLTVMAALFHDIGKASQAFQAKLRNRGKPMADAYRHEWVSLRLFEAFVGPGSSDEDWLRRLADKRETGDAWLSQLARDDRQSAPPGPFQKSRLPPLAQAVGWLIVSHHRLPNGDHRGSASLARLPAPIQSQWCGARDADAKEKAACWQFPHGLPFASAHWRARTALCAQSMLERPGLLARGPALLHDSYVMHVSRLILMLADHHYSSLPADSRLGDPNFPLHANTDRDSGKLKQRLDEHLLGVALHSRKLAGTLPRLERQLPRLARHKGFTRRVEQPRFRWQDKAYDCAMACREQAMEHGFFGLNLASTGCGKTLANGRILYALADPQRGARFSIALGLRSLTLQTGQAYRERLGLGDDDLAILVGGSAARELFEKQQERLERSGSESAQELLAENSHVHFAGTLEDGPLREWLGRNSAGNRLLQAPILACTIDHLMPASESLRGGHQIAPLLRLMTSDLVLDEVDDFDIDDLPALSRLVHWAGLFGSRVLLSSATLPPALVQGLFEAYRSGREIFQRHRGAPGRATEIRCAWFDEFSSQSSAHGAVTSFSEAHATFVAQRLAKLEQLPPRRQAQLCTVHAAGEARPALCRELAGQMNTWMADLHRCHHTEHQGRRISFGLLRLANIEPLIELAQAILAQGAPEGLHVHLCVYHSRHPLLVRSAIERQLDELLKRSDDDAAALFARPTLAKALQASTERDHLFVVLASPVAEVGRDHDYDWAIVEPSSMRSIIQLAGRIRRHRSGFSGEANLYLLSRNIRSLEGQNPAFQRPGFETPDFPLDSHDLHDLLDPALLARIDASPRIVEPFPLFPRSRLVDLEHRRLRALMLADDPPSSLLGVPLWWQTPASLSGALQTSQPFRAGAKERCYALLPDEDDEERLHFSRYEEGTWSNQDNLLRNLDLTYGPRIQTWGTVNYREELVAMAGREDLDLRQCAMRYGEVRLRENTQGWSYHPYLGFKKYN DIP protein Q02ML8 original sequence version: 47 cas6_pseab CRISPR-associated endonuclease Cas6/Csy4 cas6f csy4 PA14_33300 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF DIP protein Q02MM2 original sequence version: 26 DIP protein Q02MM2 original sequence version: 43 a0a0h2ziz8_pseab PA14_68470 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG AD451432FC61ED58 csy3_pseab CRISPR-associated protein Csy3 csy3 csy1-3 PA14_33310 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK DIP protein Q02MM1 original sequence version: 28 DIP protein Q02MM1 original sequence version: 45 h6v8p1_9caud HMPREFV_HMPID9848gp0037 protein protein pseudomonas phage jbd26 Pseudomonas phage JBD26 MMTISKTDIDCYLQTYVVIDPVSNGWQWGIDENGVGGALHHGRVEMVEGENGYFGLRGATHPTEKEAMAAALGYLWKCRQDLVAIARNDAIEAEKYRAKA DIP protein H6V8P1 original sequence version: 4 l7p7m1_9caud JBD30_035 protein protein pseudomonas phage jbd30 Pseudomonas phage JBD30 MKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP DIP protein L7P7M1 original sequence version: 7 cas1_pseab CRISPR-associated endonuclease Cas1 cas1 PA14_33350 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MDDISPSELKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGRHSHYWNIPIANTTSLLLGTGTSITQAAMRELARAGVLVGFCGGGGTPLFSANEVDVEVSWLTPQSEYRPTEYLQRWVGFWFDEEKRLVAARHFQRARLERIRHSWLEDRVLRDAGFAVDATALAVAVEDSARALEQAPNHEHLLTEEARLSKRLFKLAAQATRYGEFVRAKRGSGGDPANRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLIKDSLILPQAFLSAMRGDEEQDFRQACLDNLSRAQALDFMIDTLKDVAQRSTVSA DIP protein Q02ML7 original sequence version: 17 csy2_pseab CRISPR-associated protein Csy2 csy2 PA14_33320 protein protein pseab Pseudomonas aeruginosa (strain UCBPP-PA14) MSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA DIP protein Q02MM0 original sequence version: 25 DIP protein Q02MM0 original sequence version: 40 l7p7r7_9caud JBD5_035 protein protein pseudomonas phage jbd5 Pseudomonas phage JBD5 MSNTISDRIVARSVIEAARFIQSWEDADPDSLTEDQVLAAAGFAARLHEGLQATVLQRLVDESNHEEYREFKAWEEALLNADGRVASSPFADWGWWYRIANVMLATASQNVGVTWGSRVHGRLMAIFQDKFKQRYEEQA DIP protein L7P7R7 original sequence version: 5 acr30_bpd31 Anti-CRISPR protein 30 orf30 Gene product 30 protein protein bpd31 Pseudomonas phage D3112 Bacteriophage D3112 MIAQQHKDTVAACEAAEAIAIAKDQVWDGEGYTKYTFDDNSVLIQSGTTQYAMDADDADSIKGYADWLDDEARSAEASEIERLLESVEEE DIP protein Q6TM72 original sequence version: 28 cas1-1 21 38 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cas1-2 25 38 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cas6f-csy1-1 18 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-2 4 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy3-cas6f-1 6 33 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 39 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role prey prey ecolx Escherichia coli association association cas6f-csy1-3 11 33 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 39 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role prey prey ecolx Escherichia coli association association cas6f-csy1-4 16 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy2-cas6f-1 15 33 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 39 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 31 unspecified role unspecified role prey prey ecolx Escherichia coli association association cas6f-csy1-5 12 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-1 2 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction csy1-cas6f-1 27 33 unspecified role unspecified role prey prey ecolx Escherichia coli 35 unspecified role unspecified role prey prey ecolx Escherichia coli 39 unspecified role unspecified role prey prey ecolx Escherichia coli 31 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association cas6f-csy3-1 5 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-6 7 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-2 14 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-7 22 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-3 10 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-4 3 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cas6f-csy1-8 26 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-9 8 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-5 1 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-10 28 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy1-csy2-6 23 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas6f-csy1-11 30 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association cas3-l7p7r7_9caud-1 29 32 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 40 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cas6f-csy1-12 13 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association csy3-l7p7m1_9caud-1 17 37 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction cas6f-csy1-13 24 36 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 33 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 39 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 31 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli physical association physical association rsmn-1 19 34 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rsmn-2 9 34 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction rsmn-3 20 34 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction