IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Plant J. (0960-7412) 2008 Skirpan A., Wu X., McSteen P. pcm11@psu.edu 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Skirpan A., Wu X., McSteen P. pcm11@psu.edu Accepted 2008-SEP-14 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 jyoti Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. Plant Cell (1040-4651) 2005 Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu maize cDNA library screened in vitro In vitro pull down pull down predetermined predetermined participant predetermined Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. maize cDNA library screened Plant Cell (1040-4651) 2005 Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Li J., Smith GP., Walker JC. walkerj@missouri.edu 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Li J., Smith GP., Walker JC. walkerj@missouri.edu Accepted 2008-Not a month!-15 by ORCHARD. 03-Feb-2009: Contacted by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 orchard Only protein-protein interactions imex curation Specific interactions with TBP and TFIIB in vitro suggest that 14-3-3 proteins may participate in the regulation of transcription when part of a DNA binding complex. Specific interactions with TBP and TFIIB in vitro suggest that 14-3-3 proteins may participate in the regulation of transcription when part of a DNA binding complex. Plant Cell (1040-4651) 1999 imex curation Pan S., Sehnke PC., Ferl RJ., Gurley WB. The VP16 protein mentioned in this study could not be unambiguously identified and therefore interactions involving this protein were not curated. wgurley@micro.ifas.ufl.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Pan S., Sehnke PC., Ferl RJ., Gurley WB. The VP16 protein mentioned in this study could not be unambiguously identified and therefore interactions involving this protein were not curated. wgurley@micro.ifas.ufl.edu Accepted 2009-JUN-27 by JYOTI. Plant Cell (1040-4651) 1999 jyoti Only protein-protein interactions imex curation Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase. Structure of the electron transfer complex between ferredoxin and ferredoxin-NADP(+) reductase. Nat. Struct. Biol. (1072-8368) 2001 Kurisu G., Kusunoki M., Katoh E., Yamazaki T., Teshima K., Onda Y., Kimata-Ariga Y., Hase T. PDBe - Data obtained from the Protein Data Bank Europe kurisu@protein.osaka-u.ac.jp in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kurisu G., Kusunoki M., Katoh E., Yamazaki T., Teshima K., Onda Y., Kimata-Ariga Y., Hase T. PDBe - Data obtained from the Protein Data Bank Europe kurisu@protein.osaka-u.ac.jp Nat. Struct. Biol. (1072-8368) 2001 Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2. J. Biol. Chem. (0021-9258) 2003 imex curation Lara P., Onate-Sanchez L., Abraham Z., Ferrandiz C., Diaz I., Carbonero P., Vicente-Carbajosa J. Assays were carried out at 23C and 30C. jvicente@bit.etsia.upm.es. 14-May-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Lara P., Onate-Sanchez L., Abraham Z., Ferrandiz C., Diaz I., Carbonero P., Vicente-Carbajosa J. Assays were carried out at 23C and 30C. jvicente@bit.etsia.upm.es. Accepted 2008-MAY-2 by CDEROW. 14-May-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Plant J. (0960-7412) 2008 Skirpan A., Wu X., McSteen P. pcm11@psu.edu 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. jyoti in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Skirpan A., Wu X., McSteen P. pcm11@psu.edu Accepted 2008-SEP-14 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 jyoti Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Plant J. (0960-7412) 2008 Skirpan A., Wu X., McSteen P. pcm11@psu.edu 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. jyoti in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Skirpan A., Wu X., McSteen P. pcm11@psu.edu Accepted 2008-SEP-14 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 jyoti Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Li J., Smith GP., Walker JC. walkerj@missouri.edu 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Li J., Smith GP., Walker JC. walkerj@missouri.edu Accepted 2008-Not a month!-15 by ORCHARD. 03-Feb-2009: Contacted by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 orchard Only protein-protein interactions imex curation Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Plant J. (0960-7412) 1997 imex curation Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu 14-Nov-2008: Contacted by JYOTI. Maize leaf cDNA library. jyoti Only protein-protein interactions in vitro In vitro biochemical biochemical nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Accepted 2008-DEC-5 by JYOTI. Maize leaf cDNA library. Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Functional definition of outer membrane proteins involved in preprotein import into mitochondria Functional definition of outer membrane proteins involved in preprotein import into mitochondria Plant Cell (1040-4651) 2007 imex curation Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. seamus@cyllene.uwa.edu.au orchard Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. It was not possible to unambiguously identify the protein described as Tim23 (in this case no accession number was provided). The authors did not respond to email requests for information seamus@cyllene.uwa.edu.au Accepted 2009-JUL-12 by ORCHARD. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Plant J. (0960-7412) 1997 imex curation Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu 14-Nov-2008: Contacted by JYOTI. Maize leaf cDNA library. jyoti Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Accepted 2008-DEC-5 by JYOTI. 14-Nov-2008: Contacted by JYOTI. Maize leaf cDNA library. Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Plant J. (0960-7412) 2008 Skirpan A., Wu X., McSteen P. pcm11@psu.edu 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Skirpan A., Wu X., McSteen P. pcm11@psu.edu Accepted 2008-SEP-14 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 jyoti Functional definition of outer membrane proteins involved in preprotein import into mitochondria Functional definition of outer membrane proteins involved in preprotein import into mitochondria Plant Cell (1040-4651) 2007 imex curation Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. seamus@cyllene.uwa.edu.au orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lister R., Carrie C., Duncan O., Ho LH., Howell KA., Murcha MW., Whelan J. The authors did not respond to email requests for information seamus@cyllene.uwa.edu.au Accepted 2009-JUL-12 by ORCHARD. Plant Cell (1040-4651) 2007 orchard Only protein-protein interactions imex curation WEREWOLF, a MYB-related protein in Arabidopsis, is a position-dependent regulator of epidermal cell patterning. WEREWOLF, a MYB-related protein in Arabidopsis, is a position-dependent regulator of epidermal cell patterning. Cell (0092-8674) 1999 Lee MM., Schiefelbein J. schiefel@umich.edu 22-Jan-2008: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee MM., Schiefelbein J. schiefel@umich.edu Accepted 2007-DEC-14 by JYOTI. Cell (0092-8674) 1999 Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. Maize rough sheath2 and its Arabidopsis orthologue ASYMMETRIC LEAVES1 interact with HIRA, a predicted histone chaperone, to maintain knox gene silencing and determinacy during organogenesis. Plant Cell (1040-4651) 2005 Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu maize cDNA library screened yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Phelps-Durr TL., Thomas J., Vahab P., Timmermans MC. Chromatin - Epigenetic interactions resulting in chromatin modulation 2 timmerma@cshl.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. maize cDNA library screened Plant Cell (1040-4651) 2005 The crystal structures of Zea mays and Arabidopsis 4-hydroxyphenylpyruvate dioxygenase. The crystal structures of Zea mays and Arabidopsis 4-hydroxyphenylpyruvate dioxygenase. Plant Physiol. (0032-0889) 2004 imex curation Fritze IM., Linden L., Freigang J., Auerbach G., Huber R., Steinbacher S. Revisit when small molecule has features fritze@biochem.mpg.de 23-MAY-2007: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fritze IM., Linden L., Freigang J., Auerbach G., Huber R., Steinbacher S. Revisit when small molecule has features fritze@biochem.mpg.de Accepted 2007-JUN-15 by DAVET. 23-MAY-2007: Contacted by JYOTI. Returned mail. Plant Physiol. (0032-0889) 2004 Only protein-protein interactions imex curation Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Genetic and physical interaction suggest that BARREN STALK1 is a target of BARREN INFLORESCENCE2 in maize inflorescence development. Plant J. (0960-7412) 2008 Skirpan A., Wu X., McSteen P. pcm11@psu.edu 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. jyoti allce Allium cepa (Onion) Onion fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Skirpan A., Wu X., McSteen P. Onion epidermal tissue was transformed with constructs expressing fluorescent tag fused to proteins of interest in this assay. pcm11@psu.edu Accepted 2008-SEP-14 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Maize (Zea mays) (line OH43) immature tassel cDNA library. Plant J. (0960-7412) 2008 jyoti Control of GL2 expression in Arabidopsis leaves and trichomes. Control of GL2 expression in Arabidopsis leaves and trichomes. Development (0950-1991) 1998 imex curation Szymanski DB., Jilk RA., Pollock SM., Marks MD. dmarks@biosci.cbs.umn.edu 16-Oct-2008: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Szymanski DB., Jilk RA., Pollock SM., Marks MD. dmarks@biosci.cbs.umn.edu Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Development (0950-1991) 1998 jyoti Only protein-protein interactions imex curation Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Interaction of the maize and Arabidopsis kinase interaction domains with a subset of receptor-like protein kinases: implications for transmembrane signaling in plants. Plant J. (0960-7412) 1997 imex curation Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu 14-Nov-2008: Contacted by JYOTI. Maize leaf cDNA library. jyoti Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Braun DM., Stone JM., Walker JC. The identity of the Maize KAPP interacting protein called KBK1 in the text could not be identified unambiguously and was therefore not curated. A cDNA library of Maize leaf was screened with a radiolabelled probe made from the KI region of the Maize KAPP gene. braun@biosci.mbp.missouri.edu Accepted 2008-DEC-5 by JYOTI. 14-Nov-2008: Contacted by JYOTI. Maize leaf cDNA library. Plant J. (0960-7412) 1997 jyoti Only protein-protein interactions imex curation Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Kinase interaction domain of kinase-associated protein phosphatase, a phosphoprotein-binding domain. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 imex curation Li J., Smith GP., Walker JC. walkerj@missouri.edu 03-Feb-2009: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Li J., Smith GP., Walker JC. walkerj@missouri.edu Accepted 2008-Not a month!-15 by ORCHARD. 03-Mar-2009: Contacted by JYOTI. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 orchard Only protein-protein interactions imex curation hira_maize Protein HIRA Histone regulator protein protein protein maize Zea mays (Maize) Maize MILEKPSWIRHEGLQIFSIDIQTGGLRFATGGGDQKVRIWSMESVHKDNTNNDSKQRLLATLRDHFGSVNCVRWAKHGRYLASGSDDQVILIHERKAGSGTSEFGSGEPPDAENWKVIMTWRGHTADVVDLSWSPDDSTLASGSLDNTIHIWNMNNGICTAVLRGHTSLVKGVTWDPIGSFIASQSDDKTVMIWRTSDWSLAHKTEGHWTKSLGSTFFRRLAWSPCCHFITTTHGFQKPRHSAPVLERGEWAATFDFLGHNAPIVVVKFNNSTFRKNFSSDQDPKAAPVGWANGASKTPTKEQQPYNVIAIGSQDRTITVWTTASARPLFVARHFFSQSVVDLSWSPDGYSLFACSLDGSAANFHFEVKELGHRLSDSEMDEWKRNRYGDVGGRQSNLAESPAQLLLEQASAKQSAGEKVTSIVEQGKAPPKVSAGVPNPGLVVLSLEVPEVSHEDSKKTAGPTADDVKKGNQLSSPVKQREYRRPDGRKRIIPEAVGFASNQDNIPNHSQNHPVNFSSLDQRMNGTKPSYGSNSNSNNCGVKDRTSVTARANITESLVIQKASAGAGNDGRLSIEHTRSMAPSSLTPCSALSIHVINKNGNEDALPVCLEARPVERGAGDMIGVGALSTKETEIKCIKGTKTLWSDRISGKVTVLAGNANFWAVGCEDGFLQVYTRCGVRAMPAMMMGSAAVFIDCDDSWKLLLVTGRGLMYIWNLYDRACILHDSLASLVASPDESSAKDAGTVKVISATFSRCGSPLVALASRHAFLYDMSLKCWLRIADDCFPASNFASSFSFPQGGELGKLQIDIGKFMARKPIWSRVTDDGLQTRAHLENQLASSLALKSAQEYRQCLLSYVRFLAREADESRLREVCESFLGPPMGKVGSASPTDPKNLAWDPDVLGMKKHKLLKEDILPSMASNRKVQRLLNEFMDLLLEYETDVTLIPQPGTEGNGNGNDKVMTS DC92F705D53B8B20 as1_arath Transcription factor AS1 Protein ASYMMETRIC LEAVES 1 Myb-related protein 91 Protein PHANTASTICA AS1 MYB91 PHAN At2g37630 F13M22.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKERQRWSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVIRLQEKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQREEKESNKRVEPIDESKYDRILESFAEKLVKERSNVVPAAAAAATVVMANSNGGFLHSEQQVQPPNPVIPPWLATSNNGNNVVARPPSVTLTLSPSTVAAAAPQPPIPWLQQQQPERAENGPGGLVLGSMMPSCSGSSESVFLSELVECCRELEEGHRAWADHKKEAAWRLRRLELQLESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCRLDRP 24D9085193E6088B o80413_maize 103627788 ZEAMMB73_Zm00001d018183 protein protein maize Zea mays (Maize) Maize MALSDRSRESLLPSFLYASSARSFAATGAAARLPVSSPAPATAGAGGGVPFSIQAPKEKIEMYSPAFYAACTAGGIASCGLTHMAVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGARGFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAQKYKTLIYLAGSASAEVIADVALCPFEAVKVRVQTQPGFARGLSDGLPKFVRSEGVLGLYKGIVPLWGRQIPYTMMKFASFETIVELIYKHAVPVPKSECSKTTQLGISFAGGYIAGVFCAIVSHPADNLVSFLNNAKGATVGDAVKKLGLWGLFTRGLPLRIVMIGTLTGAQWGIYDAFKVMVGLPTTGGVTPAPAAEAELKASA 7A372332D8D416CE crk6_arath Cysteine-rich receptor-like protein kinase 6 CRK6 RLK5 Receptor-like protein kinase 5 F7H19.330 F21P8.30 At4g23140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSLISFNFLFLFSFLTSSFTASAQDPFYLNHYCPNTTTYSSNSTYSTNLRTLLSSLSSRNASYSTGFQNATAGKAPDRVTGLFLCRGDVSPEVCRNCVAFSVNQTLNLCPKVREAVFYYEQCILRYSHKNILSTAITNEGEFILSNTNTISPNQKQIDGFTSFVSSTMSEAAGKAANSSRKLYTVNTELTAYQNLYGLLQCTPDLTRADCLSCLQSSINGMALSRIGARLYWPSCTARYELYPFYNESAIETPPLPPPPPPPPPRESLVSTPPISSSSLPGKSGNSTVLVVAVVVLAVLLFIALVGYCFLAKKKKKTFDTASASEVGDDMATADSLQLDYRTIQTATNDFAESNKIGRGGFGEVYKGTFSNGKEVAVKRLSKNSRQGEAEFKTEVVVVAKLQHRNLVRLLGFSLQGEERILVYEYMPNKSLDCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKIADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKNSSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQCRAVKDPLDSDQSTTTKSFPASIDDESITDLYPR 06049FF8A3CE8FC4 o49973_maize Protein-serine/threonine phosphatase KAPP 542351 ZEAMMB73_Zm00001d019169 protein protein maize Zea mays (Maize) Maize MAVPPLLLVAVAVAALSILVLVVFAFRRCRRRRQRHPLQAAAVAPTPVAVQDEDIDRPLLSENQSDHSRQNISFLGSSVGEPSKIQTNRSNTSPRSHAIADTGRIYPAECCVTQGETHVINVENDTSEEFQLGSTLRRTPPPKWPTPDQKHRRRVSGDDNHNGSVPLKDNTYHSRLDLEVIAGPSHGISCSRQSSRPSMLPITLGRVPPSDLVLKDSEVSGKHAQINWNGKTLKWELVDMGSLNGTFLNSQAVHHPSAGSRHWGEPAELAHGDIITLGTSSKLSVQILLQNQRVPAGVGMASDPMVARRSGKKLPMEDISFCQCPLQGVEHFGLFGIFDGHGGDGAAKAVSKILPEHLGYILSHPETKERVQSYSDASDVLRYAFTLTEDTIDHQYEGCTGTALLIWFDQNKDCFAQCANLGDSACVMSVNGKTIDMTEDHRVTSATERARIARTGQPLRDGEARLSGLNLARMFGDKFLKEQDPRFSSEPYVSQAVRITKACTAFAVIASDGLWDVISTKRAVQLVVEGKERRSSGDATSAAARVASRVLDEARSLRTKDNTSVIFVDFDVLRRDPCISPVD A9FBEBA95634A690 fer1_maize Ferredoxin-1, chloroplastic FDX1 Ferredoxin I pFD1 protein protein maize Zea mays (Maize) Maize MATVLGSPRAPAFFFSSSSLRAAPAPTAVALPAAKVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA 1AF43354A9BC1D3F at2s1-arath-dna At2S1 promoter dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TTCTTACACGTGAACTC 4DB83962989C3767 q9slp6_maize Ferredoxin--NADP reductase, chloroplastic ZEAMMB73_Zm00001d045575 L-FNRI protein protein maize Zea mays (Maize) Maize MATVMAAAVSSFPSSSAVVAKASPASPCAAPHFRPRAVRAAIRAQASAVEAPATAKAKKESKKQEEGVVTNLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVDKNGKPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSLAEKDGIDWFDYKKQLKRGDQWNVEVY AE56B6A6BF471267 hpd_maize_protein 4-hydroxyphenylpyruvate dioxygenase from Zea mays protein protein maize Zea mays (Maize) Maize An amino acid sequence which is not represented in UniProt a6mw92_maize 100125650 ZEAMMB73_Zm00001d031068 bif2 protein protein maize Zea mays (Maize) Maize MDAAVRVPPALGNKTVTEVTPPPPPPAGEERLSDADTTASSTAAPNSSLSSASSAASLPRCSSLSRLSFDCSPSAALSSSSAAAAAAAASSPAPAPARPHRAGDAAWAAIRAASASAAAPLGPRDFRLLRRVGGGDVGTVYLCRLRAPPAPAPVCCLYAMKVVDRRVAAAKKKLEHAAAERRILRALDHPFLPTLFADFDAAPHFSCVVTEFCPGGDLHSLRHRMPNRRFPLPSARFYAAEVLLALEYLHMMGIVYRDLKPENVLIRADGHIMLTDFDLSLQCTSTPSLEPCAAPEAAAASCFPDHLFRRRRARLRRAASARRPPTTLVAEPVEARSCSFVGTHEYVAPEVARGGPHGAAVDWWALGVFLYELLHGRTPFAGADNEATLRNIARRPLSFPAAGAGDADARDLIARLLAKDPRHRLGSRRGAADVKAHPFFRGLNFALLRSSRPPVVPAASRSPLHRSQSCSAARTRASKPKPPPDTRFDLF 74ADF9358CFD8156 lbd6_maize LOB domain-containing protein 6 LBD6 AS2 IG1 Protein ASYMMETRIC LEAVES 2 Protein indeterminate gametophyte 1 ZmIG1 protein protein maize Zea mays (Maize) Maize MASSVPAPSGSVITVASSSSSAAAAAVCGTGSPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQQDLARAKYELSKYQAAAAASASTAPTGPQAMAEFIGNAMPNGAHNFINIGHSAALGSLGGSASVFGQEQFGNAQMLSRSYDGGEPIARLGINGGGYEFGYSTAMGGSGAVSGLGTLGISPFLKSGTAGGDEKPNGGQ LOB domain, Zn finger and leucine zipper-like motif. 1ADBFE1EE22D6DDF iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p2c70_arath Protein phosphatase 2C 70 KAPP Kinase-associated protein phosphatase Protein ROOT ATTENUATED GROWTH 1 RAG1 F7K24.30 T24G5.3 At5g19280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMIGMNIIGLFMVLMLLLISLIILFACKPWRYFSRFRSSSRFSSTFKVGDLQRPLISDDGNLIQGQTSEVTREYDLEGACYQNDGLLHSSLTEGRFYKQRLPSSSPHFSQGESFVLEVISEPSDNALVGQTLKLPAEKGSLAEVQTYDWQNNRNENLQYNLEKDRLINLSPRLVEDQRSWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMAMRRGGRKLPMEDVCHYKWPLPGANKFGLFCVCDGHGGSGAAQSAIKIIPEVLANILSDSLRKEKVLSKRDASDVLRDMFAKTEARLEEHQYEGCTATVLLVWKDNEENFFAQCANLGDSACVIHLGGRYIQMTEDHRVVSLSERKRFQEAGLALRDGETRLFGINLARMLGDKFPKQQDSRFSAEPYISEPLRIDQSSKDVFAVLASDGLWDVVSPKKAVQLVLQMRDKERGRESSAEKIANGLLNEARAMRTKDNTSIIYLDFDTSL EE0C2A41E55E100D rs2_maize Protein rough sheath 2 Protein PHANTASTICA ZmPHAN RS2 protein protein maize Zea mays (Maize) Maize MKERQRWRPEEDAVLRAYVRQYGPREWHLVSQRMNVALDRDAKSCLERWKNYLRPGIKKGSLTEEEQRLVIRLQAKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQRELRDSRRPPPEPSPDERGRYEWLLENFAEKLVGERPQQAAAAPSPLLMAAPVLPPWLSSNAGPAAAAAAAVAHPPPRPPSPSVTLSLASAAVAPGPPAPAPWMPDRAAADAAPYGFPSPSQHGGAAPPGMAVVDGQALAELAECCRELEEGRRAWAAHRREAAWRLKRVEQQLEMEREMRRREVWEEFEAKMRTMRLEQAAAAERVERDHREKVAELRRDAQVKEEKMAEQWAAKHARVAKFVEQMGGCSRSWSSATDMNC B46825CA38003EE4 o49974_maize Receptor-like serine/threonine-protein kinase KIK1 protein protein maize Zea mays (Maize) Maize MVSSPRLLFLLLAGASLCCVAAQKTDTLRQGESLSGAATLVSSPEGVFEAGFFAPDPKQPSRQYLGIWYHSISPRTVVWVANRVAPATSASPSLTLTVTGDLRVLDGTAANGTADAPLLWSSNTTSRAGPRGGYSAVLQDTGSLEVRSEDGVLWDSFWHPTDTILSGMRITLQAPGRGPKERMLFTSWASETDPSPGRYALGLDPGNSGQAYIWKDGNVTYWRSGQWNGVNFIGIPWRPLYRSGFTPAIDPVLGNYYTYTATNTSLQRFVVLPNGTDICYMVRKSSQDWELVWYQPSNECEYYATCGPNAKCTASQDGKAKCTCLKGFHPKLQEQWNAGNWSQGCIRSPPLGCETNQSGDGFLPMGNIKWPDFSYWVSTVGDEPGCRTVCLNNCSCGAYVYTATTGCLAWGNELIDMHELQTGAYTLNLKLPASELRGHHPIWKIATIISAIVLFVLAACLLLWWKHGRNIKDAVHGSWRSRHSSTQSQQNSAMLDISQSIRFDDDVEDGKSHELKVYSLDRIRTATSNFSDSNKLGEGGFGPVYMGTLPGGEEVAVKRLCRNSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIPREEKILVYEYMPNKSLDAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRAVSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQVLRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIESSKSSEKDRSHSIGTVTMTQLHGR FF479F90477A25EA q43393_brana Receptor-like serine/threonine-protein kinase protein protein brana Brassica napus (Rape) MKGVRNIYHHSYTSFLLLFLVMILIHPALSIYINTLSSTESLTISSNRTLVSPGDVFELGFFETNSRWYLGMWYKKLPFRTYVWVANRDNPLSNSIGTLKISGNNLVILGHSNKSVWSTNLTRGIDRSTVVAELLANGNFVMRDSNNNDASQFLWQSFDYPTDTLLPEMKLGNDLKTGLNRFLTSWRSSDDPSSGEFLYELETGRLPEFYLSKGIFPAYRSGPWNGIRFSGIPDDQKLSYLVYNFTENSEEVVYTFRMTNNSIYSKLTVSLSGYFERQTWNASLGMWNVSWSLPLPSQCDTYRRCGPYAYCDVSTSPICNCIQGFNPSNVQQWDQRSWSGGCIRRTRLSCSGDGFTRMENMELPETTMAIVDRSIGVKECKKRCLSDCNCTAFANADVQNGGTGCIIWAGELEDIRNYAADGQDLYVRLAAADLVKRRNANGQIISLTVGVSVLLLLIMFCLWKRKQKRANANATSIANRQRNQNLPMNGMVLSSKREFLEEKKIEELELPLIELETVVKATENFSNCNKLGQGGFGIVYKGRLLDGQEIAVKRLSKTSVQGTDEFMNEVTLIARLQHINLVQIIGCCIEADEKMLVYEYLENLSLDSYLFGKTRRSKLNWKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKISDFGMARIFARDETEANTVKVVGTYGYMSPEYAMHEIFSEKSDVFSFGVIVLEIVSGKKNSYNLNYKNNLLSYAWSQWEEGRALEIIDPVIVDSLPSTFQPQEVLKCIQIGLLCVQELAEHRPTMSSVVWMLGSEAKEIPQPKQPGHCIGRSPYDLDPSSSSQCDDDESWTVNQYTCSLVDAR 9EF3AAD47831ECCE to204_arath Mitochondrial import receptor subunit TOM20-4 TOM20-4 Translocase of outer membrane 20 kDa subunit 4 MMG1.2 At5g40930 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDMQNENERLMVFEHARKVAEATYVKNPLDAENLTRWAGALLELSQFQTEPKQMILEAILKLGEALVIDPKKHDALWLIGNAHLSFGFLSSDQTEASDNFEKASQFFQLAVEEQPESELYRKSLTLASKAPELHTGGTAGPSSNSAKTMKQKKTSEFKYDVFGWVILASYVVAWISFANSQTPVSRQ 156DF3D231EA286C q3v810_maize pac1 103627556 WD40.1 ZEAMMB73_Zm00001d017616 protein protein maize Zea mays (Maize) Maize MDPPKPPSSVASSSGPETPNPHAFTCELPHSIYALAFSPVAPVLASGSFLEDLHNRVSLLSFDPVRPSAASFRALPALSFDHPYPPTKLQFNPRAAAPSLLASSADTLRIWHTPLDDLSDTAPAPELRSVLDNRKASSEFCAPLTSFDWNEVEPRRIGTASIDTTCTVWDIDRGVVETQLIAHDKAVHDIAWGEAGVFASVSADGSVRVFDLRDKEHSTIVYESPRPDTPLLRLAWNRSDLRYMAALLMDSSAVVVLDIRAPGVPVAELHRHRACANAVAWAPQATRHLCSAGDDGQALIWELPETAAAVPAEGIDPVLVYDAGAEINQLQWAAAHPDWMAIAFENKVQLLRV 3EA19C2740DFA49B cri4_maize Putative receptor protein kinase CRINKLY4 CR4 protein protein maize Zea mays (Maize) Maize MDHVPALVLAGCCFLALLPGWACGLGSMSSIAVSYGEDGPVFCGLNSDGSHLVACFGADASVLYGAPPNIPFLGLTAGDGFVCGLLLDTRQPYCWGSNSYVKSGVPQPMVEGARYSELSAGDNHLCALRAAQDGGRGSSAATSLIDCWGYNMTATHAVDEAVSTVSAGSVFNCGLFARNRTVFCWGDETVSGVVGLAPRDLHFQSIGAGGYHVCGVLENAQVFCWGRSLEMQQVVPSSAIGDGDVNIVPMDAMSTVVGGRFHACGIRSLDHQVACWGFTLHNSTSPPKGLKMYALVAGDYFTCGVPAETSLMPRCWGNSGPLALPMAVPPGICVPTACSHGYYEYVNHGEVGSIKVCKPANSRLCLPCSTGCPEGLYESSPCNATADRVCQFDCLKCVTDECLSFCLSQKRTKSRKLMAFQMRIFVAEIVFAVVLVLSVSVTTCLYVRHKLRHCQCSNRELRLAKSTAYSFRKDNMKIQPDMEDLKIRRAQEFSYEELEQATGGFSEDSQVGKGSFSCVFKGILRDGTVVAVKRAIKASDVKKSSKEFHNELDLLSRLNHAHLLNLLGYCEDGSERLLVYEFMAHGSLYQHLHGKDPNLKKRLNWARRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEALKKIASVACKCVRMRGKDRPSMDKVTTALEHALALLMGSPCIEQPILPTEVVLGSSRMHKVSQMSSNHSCSENELADGEDQGIGYRAPSWITFPSVTSSQRRKSSASEADIVGRRATDGRNVGSSIGDGLRSLEEEIAPASPQENLYLQHNF 52F8481AC187E061 oe64m_arath Outer envelope protein 64, mitochondrial At5g09420 OM64 TOC64-V Mitochondrial outer membrane protein 64 Translocon at the outer membrane of chloroplasts 64-V T5E8.220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNTLSLIQSNASNPKVWVVIGVTVAGIVILAETRKRRIRALREEDFGAFLDRFELLPFPPPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQWKKTHEAAEKTAVVVTTLLKNGATCVGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGCSSGSAVSVGAELVDFSLGIDTTGGVRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVGWFASDPSVLCQVGHALLNLSAVTHRRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSGYKTPKHVNVGQYVASNVPSLAEFCEQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWWQTCKSFLGPRFSNDVVTALKSKNESIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPPRLNTKRNKSLNEFLDRTYALSCIASMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLDTTLDVYASLQDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLRKHI 6D4191B24EB9205F tf2b_human Transcription initiation factor IIB GTF2B TF2B TFIIB General transcription factor TFIIB S300-II protein protein human Homo sapiens Human MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL DIP protein Q00403 original sequence version: 119 DIP protein Q00403 original sequence version: 181 9CC7E102526C2722 tmk1_arath Receptor protein kinase TMK1 TMK1 BARK1-like kinase 1 BLK1 Transmembrane kinase 1 F15E12.4 At1g66150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKKRRTFLLFSFTFLLLLSLSKADSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQNFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAGSQVQSLWLNGQKLTGDITVLQNMTGLKEVWLHSNKFSGPLPDFSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVPVFKSSVSVDLDKDSNSFCLSSPGECDPRVKSLLLIASSFDYPPRLAESWKGNDPCTNWIGIACSNGNITVISLEKMELTGTISPEFGAIKSLQRIILGINNLTGMIPQELTTLPNLKTLDVSSNKLFGKVPGFRSNVVVNTNGNPDIGKDKSSLSSPGSSSPSGGSGSGINGDKDRRGMKSSTFIGIIVGSVLGGLLSIFLIGLLVFCWYKKRQKRFSGSESSNAVVVHPRHSGSDNESVKITVAGSSVSVGGISDTYTLPGTSEVGDNIQMVEAGNMLISIQVLRSVTNNFSSDNILGSGGFGVVYKGELHDGTKIAVKRMENGVIAGKGFAEFKSEIAVLTKVRHRHLVTLLGYCLDGNEKLLVYEYMPQGTLSRHLFEWSEEGLKPLLWKQRLTLALDVARGVEYLHGLAHQSFIHRDLKPSNILLGDDMRAKVADFGLVRLAPEGKGSIETRIAGTFGYLAPEYAVTGRVTTKVDVYSFGVILMELITGRKSLDESQPEESIHLVSWFKRMYINKEASFKKAIDTTIDLDEETLASVHTVAELAGHCCAREPYQRPDMGHAVNILSSLVELWKPSDQNPEDIYGIDLDMSLPQALKKWQAYEGRSDLESSTSSLLPSLDNTQMSIPTRPYGFAESFTSVDGR DIP protein P43298 original sequence version: 131 93E300B52FF549DE wer_arath Transcription factor WER Protein WEREWOLF Myb-related protein 66 WER MYB66 At5g14750 T9L3.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKKVSSSGDEGNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQGSNYLSSLWVHEDEFELSTLTNMMDFIDGHCF EFAB8A342F0FB66F q5mp56_maize BA1 bHLH67 542186 protein protein maize Zea mays (Maize) Maize MDPYHYQTMYDPRGFPIIHPQPYLQHPVAGALGDSRVRGGGSGARRRPGAKLSTDPQSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKTQISLHQAALMQHEEGCHAELAAYSAVAVVGDNEVTLASHGRTGACDEMMQLQVAAEEALSYGVDAHQPYGLDPRQLSGGHELPPLPASCIFLEEPADACYSVCDLDDGDTGLPGSY 3DE28D16257DCDAB gl1_arath Trichome differentiation protein GL1 GL1 MYB0 K16N12.17 At3g27920 Protein GLABROUS 1 Protein GLABRA 1 R2R3-MYB transcription factor GL1 Myb-related protein 0 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL DIP protein P27900 original sequence version: 134 822A8646F446F6B9 crk10_arath Cysteine-rich receptor-like protein kinase 10 CRK10 RLK4 Receptor-like protein kinase 4 F21P8.70 At4g23180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRNTDQESPIMSYYSSFFFLFLFSFLTSFRVSAQDPTYVYHTCQNTANYTSNSTYNNNLKTLLASLSSRNASYSTGFQNATVGQAPDRVTGLFNCRGDVSTEVCRRCVSFAVNDTLTRCPNQKEATLYYDECVLRYSNQNILSTLITTGGVILVNTRNVTSNQLDLLSDLVLPTLNQAATVALNSSKKFGTRKNNFTALQSFYGLVQCTPDLTRQDCSRCLQLVINQIPTDRIGARIINPSCTSRYEIYAFYTESAVPPPPPPPSISTPPVSAPPRSGKDGNSKVLVIAIVVPIIVAVLLFIAGYCFLTRRARKSYYTPSAFAGDDITTADSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVVRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLLGSVDDASITDIHPR E2CCD6AAC5F87BF7 14331_maize 14-3-3-like protein GF14-6 GRF1 protein protein maize Zea mays (Maize) Maize MASAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNEDRVTLIKDYRGKIETELTKICDGILKLLETHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQDIALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDNLTLWTSDISEDPAEEIREAPKRDSSEGQ 25EC70725A5F6801 kpro_maize Putative receptor protein kinase ZmPK1 PK1 protein protein maize Zea mays (Maize) Maize MPRPLAALLSTACILSFFIALFPRAASSRDILPLGSSLVVESYESSTLQSSDGTFSSGFYEVYTHAFTFSVWYSKTEAAAANNKTIVWSANPDRPVHARRSALTLQKDGNMVLTDYDGAAVWRADGNNFTGVQRARLLDTGNLVIEDSGGNTVWQSFDSPTDTFLPTQLITAATRLVPTTQSRSPGNYIFRFSDLSVLSLIYHVPQVSDIYWPDPDQNLYQDGRNQYNSTRLGMLTDSGVLASSDFADGQALVASDVGPGVKRRLTLDPDGNLRLYSMNDSDGSWSVSMVAMTQPCNIHGLCGPNGICHYSPTPTCSCPPGYATRNPGNWTEGCMAIVNTTCDRYDKRSMRFVRLPNTDFWGSDQQHLLSVSLRTCRDICISDCTCKGFQYQEGTGSCYPKAYLFSGRTYPTSDVRTIYLKLPTGVSVSNALIPRSDVFDSVPRRLDCDRMNKSIREPFPDVHKTGGGESKWFYFYGFIAAFFVVEVSFISFAWFFVLKRELRPSELWASEKGYKAMTSNFRRYSYRELVKATRKFKVELGRGESGTVYKGVLEDDRHVAVKKLENVRQGKEVFQAELSVIGRINHMNLVRIWGFCSEGSHRLLVSEYVENGSLANILFSEGGNILLDWEGRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQAFEPKITDFGLVKLLNRGGSTQNVSHVRGTLGYIAPEWVSSLPITAKVDVYSYGVVLLELLTGTRVSELVGGTDEVHSMLRKLVRMLSAKLEGEEQSWIDGYLDSKLNRPVNYVQARTLIKLAVSCLEEDRSKRPTMEHAVQTLLSADD F164B44719922E67 mtx_arath Mitochondrial outer membrane import complex protein METAXIN MTX1 T20K24.9 At2g19080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGDQETNVYTLVARKPSFDLPTACPNCLPAYIYLKLAQLPFELAFNSTFPDSDELPYFESDTYVAYNNEDGGVIEKLKKDGIVNLDSQLQSLSDYLSLKALIVSWLEEALTYEIWVGTEGISTSKIYYSDLPWVISKVLFYKQTYLAKNRLGITKENAEQREKQIYKRASEAYEALSTRLGEQKFLFEDRPSSLDAFLLSHILFIIQALPVTSVLRCKLLEHSNLVRYAEKLKSEFLEASSSSPSPPLHSFPSSFPRKSSKPKSKPKVEKTEEEKKFKKRARFFLAAQFLAVVIYVSVMGGGSSDELEYEDEDD 31933D9255F33B55 o04724_maize R protein protein maize Zea mays (Maize) Maize MALSASRVQQAEELLQRPAERQLMRSQLAAAARASTGATPSSGPFQTLNQ DA7DBAA3399A7DCD wrky1_maize Protein WRKY1 WRKY DNA-binding protein 1 protein protein maize Zea mays (Maize) Maize MEGMEEANRTAVESCHRVLALLSNPHGQLVPSKELVAATGEAVAKFGSLTAKLSNSNGDGLLQGHARVRKVKKPLHIFDSNLFLESSAVAAAAAPAKTPSPSPILGLQLFPRYHQFEGSSSKDPVRIPTQFPKRLLLEKPTAGMEGSTSQSPPIVQMVQPVSVAPPAGTPTPALPPAHLHFIQQQQSYQRFQLMQQMKIQSEMMKRSNLGDQGGSLSGGGGGGRKGVNLKFDSSNCTASSSRSFLSSLSMEGSLASLDGSRTSRPFQLLSGSQTASTPELGLVQRRRCAGREDGTGRCATGSRCHCSKKRKLRIRRSIKVPAISNKVADIPADEFSWRKYGQKPIKGSPHPRGYYKCSSVRGCPARKHVERCVDDPSMLIVTYEGDHNHNRVLAQPA 47504446CD5BBDB5 op2_maize Regulatory protein opaque-2 O2 protein protein maize Zea mays (Maize) Maize MEHVISMEEILGPFWELLPPPAPEPEREQPPVTGIVVGSVIDVAAAGHGDGDMMDQQHATEWTFERLLEEEALTTSTPPPVVVVPNSCCSGALNADRPPVMEEAVTMAPAAVSSAVVGDPMEYNAILRRKLEEDLEAFKMWRADSSVVTSDQRSQGSNNHTGGSSIRNNPVQNKLMNGEDPINNNHAQTAGLGVRLATSSSSRDPSPSDEDMDGEVEILGFKMPTEERVRKKESNRESARRSRYRKAAHLKELEDQVAQLKAENSCLLRRIAALNQKYNDANVDNRVLRADMETLRAKVKMGEDSLKRVIEMSSSVPSSMPISAPTPSSDAPVPPPPIRDSIVGYFSATAADDDASVGNGFLRLQAHQEPASMVVGGTLSATEMNRVAAATHCAGAMELIQTAMGSMPPTSASGSTPPPQIMSCWVQMGPYTWTCIRHCGFRDRWEHFICRRR 513A8AB8D5ABD999 rik_maize Protein RIK Rough sheath 2-interacting KH domain protein protein protein maize Zea mays (Maize) Maize MTEDRAHKVADEPAASGRQSPERKKRKWDQPAEDLVSAAVTAAAVSGMPVMNFGALPGVVLPGVTAYGAATLPSVVPVPYSLPPHIAPSVLQNAAAAAQKLSQAKIPDEVIAREIVINDADPSVRYKLTKRQTQEEIQKCTNTVIITRGKYHPPNLLPDGEKPLYLHISAGSQLKDTAERIKAVDRAASMIEEILKQGTTSESISVPFSSSTGQAVRPFSASVFLGFDADPSLNITARIRGPNDQYINHIMKETGVTVVLRGKDSENLGSCHSEASQQPLHLYLTSMHLKNLEAAKVLAENLLDTVAAEFGASRISSSKVYGAVPPPQQLLAGVDTSGTKSDVHYIVGPNVLSGATHSFASTGVIAPVVAPAVTVQSGAPTYSGVPLPSNMAYPIPPANGGAFYSGYGDIYPQATPLQQLAFTLKHASSSATQAVPVTSTPTSMATKGNSILDAEMDKRSRRKFQELPVSKGPATESQNSQQGSKFVKTGLDSSGNIGSSSIAPPKKVHPGSNGMLPQEEADMPSHLSISTKMLPPPLKSMLPLPPRSMPPPPPKSMPPPPPKFPSDEFLSRNENKFFPLKEPTAPPRSFDAISVLPSERRPREPKEEKNKRHTCV 1B9697DB68B51DBA to202_arath Mitochondrial import receptor subunit TOM20-2 TOM20-2 Translocase of outer membrane 20 kDa subunit 2 F17L21.18 At1g27390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFSTADFERLIMFEHARKNSEAQYKNDPLDSENLLKWGGALLELSQFQPIPEAKLMLNDAISKLEEALTINPGKHQALWCIANAYTAHAFYVHDPEEAKEHFDKATEYFQRAENEDPGNDTYRKSLDSSLKAPELHMQFMNQGMGQQILGGGGGGGGGGMASSNVSQSSKKKKRNTEFTYDVCGWIILACGIVAWVGMAKSLGPPPPAR 022DF12F83586A46 to203_arath Mitochondrial import receptor subunit TOM20-3 TOM20-3 Translocase of outer membrane 20 kDa subunit 3 MOJ10.15 At3g27080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTETEFDRILLFEQIRQDAENTYKSNPLDADNLTRWGGVLLELSQFHSISDAKQMIQEAITKFEEALLIDPKKDEAVWCIGNAYTSFAFLTPDETEAKHNFDLATQFFQQAVDEQPDNTHYLKSLEMTAKAPQLHAEAYKQGLGSQPMGRVEAPAPPSSKAVKNKKSSDAKYDAMGWVILAIGVVAWISFAKANVPVSPPR F86A54F827F3A6D1 rs2-as2-1 16 32 unspecified role unspecified role prey prey 35 unspecified role unspecified role bait bait physical association physical association rs2-wrky1-1 16 35 unspecified role unspecified role bait bait 52 unspecified role unspecified role prey prey physical association physical association rs2-rik-1 16 35 unspecified role unspecified role bait bait 54 unspecified role unspecified role prey prey physical association physical association rs2-hira-1 16 35 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association rs2-as2-2 2 32 unspecified role unspecified role prey prey in vitro In vitro 35 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction rs2-wrky1-2 2 52 unspecified role unspecified role prey prey in vitro In vitro 35 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction rs2-rik-2 2 54 unspecified role unspecified role prey prey in vitro In vitro 35 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction rs2-hira-2 2 35 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 22 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction as1-hira-1 2 22 unspecified role unspecified role prey prey in vitro In vitro 23 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction fdx1-l_fnri-1 5 29 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 27 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction , dimeric, multimeric, monomeric working 76.800%, free 70.300% 2.59A hpd-2 17 30 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 33 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 2.00A working 27.5%, free 32.4% The asymmetric unit of the Z. mays HPPD crystals of space group P212121 contains two dimers of 44.8-kD subunits (Fig. 2A ) r-wer 15 44 unspecified role unspecified role prey prey 39 unspecified role unspecified role bait bait physical association physical association 6 Although strains containing only the BD-R fusion induced some lacZ transcription, yeast harboring a combination of the AD-WER and BD-R constructs exhibited the highest level of lacZ reporter activity The R protein was identified from references provided in the text o2-dna-4 6 28 unspecified role unspecified role neutral component neutral component 53 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Figure 4C EMSA experiments shown in Fig. 4C, display the binding behavior of different amounts of AtbZIP10 or O2 proteins incubated with target DNA sequences. A clear increase in the binding of both proteins to their target sites was obtained in the presence of ABI3 The presence of the ABI3 (Q01593) protein increased protein binding to DNA It is not clear from the text if recombinant or in vitro synthesised proteins were used. bif2-ba1 13 45 unspecified role unspecified role prey prey 31 unspecified role unspecified role bait bait physical association physical association BIF2 interacts with BA1 in yeast and in vitro bif2-ba1-1 1 31 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 45 unspecified role unspecified role prey prey physical association physical association To define the regions of BIF2 sufficient for interaction, truncations of BIF2 were generated and assayed for interaction with BA1 by growth on selective media (Figure 2a). Constructs lacking the conserved kinase domain of BIF2 did not interact with BA1, suggesting that the kinase domain is required for interaction, or that such extensive deletions did not allow BIF2 to fold properly (Figure 2a). Furthermore, a construct lacking just 59 amino acids of the C terminus of BIF2 did not interact with BA1, indicating that the C terminus of BIF2 may play a role in the interaction with BA1 (Figure 2a). Figure 2a bif2-ba1-2 7 45 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 31 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association To confirm the interaction observed in yeast, glutathione S-transferase (GST)-tagged BIF2 and 6 x HIS-tagged BA1 were expressed in bacteria and subjected to GST pull-down assays (Figure 2b). Bacterial lysate containing HIS-BA1 was incubated with glutathione sepharose resin bound to either GST alone or GST-BIF2. GST-BIF2 pulled down the BA1 protein from the bacterial lysate, as detected by western analysis Figure 2b bif2 8 31 putative self putative self putative self putative self region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 20:15:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys161arg' Tue Jun 30 19:04:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys161Arg' A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 20:10:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp258ala' Tue Jun 30 15:43:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp258Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true BIF2 autophosphorylates and transphosphorylates BA1 in vitro Figure 3 Bif2 was shown to autophosphorylate. bif2-ba1-3 8 45 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 31 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A6MW92:p.Lys161Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K R Wed May 02 19:49:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys161arg' Tue Jun 30 15:52:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys161Arg' A6MW92:p.Asp258Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:57:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp258ala' Tue Jun 30 16:54:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp258Ala' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation BIF2 autophosphorylates and transphosphorylates BA1 in vitro Figure 3 Phosphorylation of BA1 (Q5MP56). bif2-ba1-4 18 31 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 45 unspecified role unspecified role neutral component neutral component region mCherry red fluorescent tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization BIF2 and BA1 colocalize in the nucleus Figure 5 Proteins colocalised to the nucleus. gl1-r 19 46 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 51 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Figure 9C The authors state "since the myb domain of GL1 could not efficiently precipitate R it indicates that something in the carboxy terminus of GL1 is also necessary for a stable interaction and that the myc epitope itself is not the source of the interaction". The translated proteins were incubated together prior to immunoprecipitation. Under these conditions it was found that R only immunoprecipitated in the presence of full-length GL1 kapp-kik1 21 36 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O49974:p.Lys558Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:09:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys558glu' Tue Jun 30 20:23:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys558Glu' 34 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P46014:p.Gly211Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:27:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly211glu' Tue Jun 30 16:08:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly211Glu' P46014:p.Ser226Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:53:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser226ala' Tue Jun 30 18:03:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser226Ala' P46014:p.His229Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain H L Wed May 02 17:36:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his229leu' Tue Jun 30 18:19:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His229Leu' P46014:p.Asn250Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N S Wed May 02 17:48:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn250ser' Tue Jun 30 17:29:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn250Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2D Figure 2E A modified dot-blot immuno analysis was performed to test the binding between GST fusions (KAPP mutants) and MBP fusions (MBP, KIK1 and K558E). kapp-kik1-1 3 36 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O49974:p.Lys558Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Wed May 02 14:45:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys558glu' Tue Jun 30 17:27:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys558Glu' ecoli Escherichia coli (strain K12) 34 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3B Representative binding results between GST fusion proteins (GST, KID119, and KID239) and MBP fusion proteins [MBP (●), RLK5 (○), CLV1 (■), KIK1 (▴), and K558E (▾)] by ELISA kapp-kik1-2 9 36 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 34 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 4 Representative SPR sensorgrams of the binding between analytes, GST-KAPP mutants, and ligands, MBP-KIK1 and MBP-CLV1, from BIAcore 2000. Temp=25C kapp-kapp 10 26 unspecified role unspecified role prey prey 34 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 1 The authors state that "we screened a maize leaf cDNA library at reduced stringency using the Arabidopsis KI domain as a hybridization probe", however the amino acid coordinates of this region are not provided. The KI domain is thought to be equivilent to the FHA (IPR000253) domain recorded in the UniProt entry for this protein. This range has been used to represent the KI region and entered as 'fuzzy coordinates', (see IntAct annotation manual availaible on the IntAct website), to indicate the fact that the exact coordinates are unknown. To isolate maize kinase interaction domain-containing genes, we screened a maize leaf cDNA library at reduced stringency using the Arabidopsis KI domain as a hybridization probe. Approximately 3.2 x 105 plaques were screened and five positive clones identified. All positive clones corresponded to the maize homolog of KAPP; no other genes containing a KI domain were identified. The longestlength cDNA insert was sequenced and encodes the complete protein as shown by comparison to the Arabidopsis protein kapp-kik-3 10 36 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 2 Characterization of KI domain interacting kinase 1 (KIK1). kik-4 20 36 putative self putative self putative self putative self region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O49974:p.Lys558Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain K E Wed May 02 15:20:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys558glu' Tue Jun 30 17:44:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys558Glu' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Figure 3 Figure 5b Recombinant proteins were expressed in E. coil, affinitypurified, incubated in the presence of [P-32p]ATP, and separated by SDS-PAGE. The KIK1CAT recombinant protein incorporates 32p while the site-directed mutated protein, K558E, is incapable of autophosphorylation O49974 was autophosphorylated (on a serine and/or threonine residue(s)). The authors concluded "these results establish that KIK1 is a serine/threonine protein kinase". kapp-kik-5 12 36 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5C The maize and Arabidopsis KI domains bind to the catalytic domains of KIK1, Arabidopsis TMK1 (Chang et al., 1992), Brassica SRK-A14 (Glavin et al., 1994), Arabidopsis RLK5 (Horn and Walker, 1994), and Arabidopsis RLK4 (Walker, 1993), but not to the kinase domains of maize CRINKLY4 (Becraft et aL, 1996), or maize ZmPK1 pk1-2 20 49 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Figure 5b autophosphorylation All of the recombinant protein kinases are capable of autophosphorylating in vitro, while the protein affinity tag, maltose binding protein (MBP) does not incorporate any 32p (Figure 5b). The maize and Arabidopsis KI domains bind to the catalytic domains of KIK1, Arabidopsis TMK1 (Chang et al., 1992), Brassica SRK-A14 (Glavin et al., 1994), Arabidopsis RLK5 (Horn and Walker, 1994), and Arabidopsis RLK4 (Walker, 1993), but not to the kinase domains of maize CRINKLY4 (Becraft et aL, 1996), or maize ZmPK1 (Walker and Zhang, 1990), or to the protein affinity tag, cr4 20 40 putative self putative self putative self putative self region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Figure 5b autophosphorylation All of the recombinant protein kinases are capable of autophosphorylating in vitro, while the protein affinity tag, maltose binding protein (MBP) does not incorporate any 32p (Figure 5b). The maize and Arabidopsis KI domains bind to the catalytic domains of KIK1, Arabidopsis TMK1 (Chang et al., 1992), Brassica SRK-A14 (Glavin et al., 1994), Arabidopsis RLK5 (Horn and Walker, 1994), and Arabidopsis RLK4 (Walker, 1993), but not to the kinase domains of maize CRINKLY4 (Becraft et aL, 1996), or maize ZmPK1 (Walker and Zhang, 1990), or to the protein affinity tag, kapp-tmk1 12 43 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5C The maize and Arabidopsis KI domains bind to the catalytic domains of KIK1, Arabidopsis TMK1 (Chang et al., 1992), Brassica SRK-A14 (Glavin et al., 1994), Arabidopsis RLK5 (Horn and Walker, 1994), and Arabidopsis RLK4 (Walker, 1993), but not to the kinase domains of maize CRINKLY4 (Becraft et aL, 1996), or maize ZmPK1 kapp-q43393 12 37 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5C kapp-crk6 12 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5C The authors state that the region of the CRK6 protein used was 649 to 999 amino acids in length. However both UniProt and TAIR records show that the CRK10 protein is 647 amino acids and 670 amino acids respectively. Note the TAIR record differs a several regions in its sequence to the UniProt record. kapp-crk10 12 47 unspecified role unspecified role prey prey region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 5C The authors state that the region of CRK10 used was 427 to 797 amino acids however both UniProt and TAIR records show the CRK10 protein to be 658 amino acids and 670 amino acids in length respectively. Note the TAIR entry has an N-terminal amino acid sequence ( MRRNTDQESPI) which the UniProt record lacks. metaxin-pic 11 24 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 50 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction Figure 7A The interactions of each of these proteins with various precursors was tested by the ability to pull down radiolabeled precursor protein with antibodies raised against TOM20-4, METAXIN, and mtOM64, respectively (Figure 7A). All three proteins interacted with various precursor proteins, AOX, PiC, FAd, TIM23, and TOM40. mto64-pic-1 11 24 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 41 unspecified role unspecified role bait bait in vitro In vitro direct interaction direct interaction Figure 7A The interactions of each of these proteins with various precursors was tested by the ability to pull down radiolabeled precursor protein with antibodies raised against TOM20-4, METAXIN, and mtOM64, respectively (Figure 7A). All three proteins interacted with various precursor proteins, AOX, PiC, FAd, TIM23, and TOM40. tf2b-grf1 4 42 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 48 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Figure 1A As shown in Figure 1A, maize 14-3-3 was retained on GST-hTFIIB beads but not on the GST control beads. tom20_4-pic-1 11 24 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 38 unspecified role unspecified role bait bait direct interaction direct interaction Figure 7A The interactions of each of these proteins with various precursors was tested by the ability to pull down radiolabeled precursor protein with antibodies raised against TOM20-4, METAXIN, and mtOM64, respectively (Figure 7A). All three proteins interacted with various precursor proteins, AOX, PiC, FAd, TIM23, and TOM40. metaxin-pic-1 14 24 unspecified role unspecified role prey prey 50 unspecified role unspecified role bait bait physical association physical association Figure 7C tom20_4-pic-2 14 24 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait physical association physical association Figure 7C mto64-pic-2 14 24 unspecified role unspecified role prey prey 41 unspecified role unspecified role bait bait physical association physical association Figure 7C tom20_2-pic-3 14 24 unspecified role unspecified role prey prey 55 unspecified role unspecified role bait bait physical association physical association Figure 7C tom20_3-pic-4 14 24 unspecified role unspecified role prey prey 56 unspecified role unspecified role bait bait physical association physical association Figure 7C MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. FEBS Lett. (0014-5793) 2009 López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri FEBS Lett. (0014-5793) 2009 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. FEBS Lett. (0014-5793) 2009 López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri in vitro In vitro pull down pull down predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri FEBS Lett. (0014-5793) 2009 Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. Maize AKINbetagamma dimerizes through the KIS/CBM domain and assembles into SnRK1 complexes. FEBS Lett. (0014-5793) 2009 López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri nicbe Nicotiana benthamiana chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined López-Paz C., Vilela B., Riera M., Pagès M., Lumbreras V. suggested by aryamontri FEBS Lett. (0014-5793) 2009 b4fx20_maize ZEAMMB73_Zm00001d044315 100286384 protein protein maize Zea mays (Maize) Maize MDQPEENPEFPSCDAYFEAIQSKKKLPLTLQESLTAAFAQIPVSSFPEVPAGRVIEIPGDTSVIDAVRTLSEQNIRAAPVLNPEPGAPTDWQGRYLGVIDYSAIILWVLENAELAAVALSAASATAAGVGMGAVGAVGVAALGTTGPAAVAGLTAAAIGASVAGGLTAEKGVAKDGLTAADHLGEDFYKVLLQQEPFRSTTVRSIVESYRWSPFVPITLDTSMLTVLLLLSKYRLRNVPVIEPEKPIIRNFITQTGVVKGLQQCKGRDWFDYISALPLSDLGLPFMSIDEVITVNSDDLILEAFKCMKDNKIGGVPVVEGPKRKLVGSVSIRDIRFLLLRPNLFSNFRQLTVIEFMKTLGSTLPDSESNCLVKPPPTCTPDASLGSVIDSIASRITHRIYVVDDDLEVVGVVTLRDVISCFIHEPPGYCDNYLASAMEKLEGKGVRSVEKI mint 281961E468D468C6 q8h1l5_maize Non-specific serine/threonine protein kinase protein protein maize Zea mays (Maize) Maize LNVRWKKNGHYNVKCRWCPGFPEVNDTLDASNSFLGDSTIMDNDDANGRLPTVVKFEFQLYKTKDDKYLLDMQRVTGPQLLFLDFCAAFLTKLRVL mint 0C2E57707084BD7B b4fx20-q8h1l5 1 SnRK1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B mint b4fx20-b4fx20 1 AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5 mint b4fx20-b4fx20-1 2 AKIN 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3A mint b4fx20-b4fx20-2 2 AKIN 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-7008618]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 497-497, sequence length 451 [EBI-7008618]124-497 AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3A mint b4fx20-b4fx20-3 2 AKIN 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F3C mint b4fx20-b4fx20-4 3 AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKIN 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association F4 mint IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Specific recognition of a multiply phosphorylated motif in the DNA repair scaffold XRCC1 by the FHA domain of human PNK. Specific recognition of a multiply phosphorylated motif in the DNA repair scaffold XRCC1 by the FHA domain of human PNK. Nucleic Acids Res. (0305-1048) 2009 imex curation Ali A.A., Jukes R.M., Pearl L.H., Oliver A.W. antony.oliver@icr.ac.uk,laurence.pearl@icr.ac.uk 28-Oct_2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Ali A.A., Jukes R.M., Pearl L.H., Oliver A.W. antony.oliver@icr.ac.uk,laurence.pearl@icr.ac.uk Accepted 2013-OCT-21 by ORCHARD 28-Oct_2013: Contacted by IntAct-Help. Nucleic Acids Res. (0305-1048) 2009 Only protein-protein interactions imex curation csk2a_maize Casein kinase II subunit alpha ACK2 CK II CK2-alpha protein protein maize Zea mays (Maize) Maize MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENSRTRA 85513A5A5C77235A xrcc1_human DNA repair protein XRCC1 XRCC1 X-ray repair cross-complementing protein 1 protein protein human Homo sapiens Human MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDESANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQESPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPRGEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHLICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGGSGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDNGAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA DIP protein P18887 original sequence version: 120 DIP protein P18887 original sequence version: 161 30DB3321234DBFC2 ack2-xrcc1 1 2 enzyme enzyme unspecified role unspecified role 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 3 enzyme target enzyme target substrate substrate unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 562-rosetta ii de3 Escherichia coli rosetta ii de3 rosetta ii de3 phosphorylation phosphorylation reaction phosphorylation Fig. 1c phosphorylation of XRCC1 on ser518, thr519 and thr523 DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133844X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Nature 2013 imex curation Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255997X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111398X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Structural basis for the delivery of activated sialic acid into Golgi for sialyation. Structural basis for the delivery of activated sialic acid into Golgi for sialyation. Nature structural & molecular biology 2019 imex curation Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Accepted 2020-MAY-13 AT 13:24 BST AT 13:24 BST by KALPANAP Nature structural & molecular biology 2019 Only protein-protein interactions imex curation imex curation A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133835X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133838X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133843X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111395X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133839X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133837X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Nature 2013 imex curation Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255998X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. The maize Gα gene COMPACT PLANT2 functions in CLAVATA signalling to control shoot meristem size. The maize Gα gene COMPACT PLANT2 functions in CLAVATA signalling to control shoot meristem size. Nature 2013 imex curation Bommert P., Je BI., Goldshmidt A., Jackson D. jacksond@cshl.edu 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation maize Zea mays (Maize) Maize anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bommert P., Je BI., Goldshmidt A., Jackson D. jacksond@cshl.edu Accepted 2018-AUG-20 AT 19:53 BST AT 19:53 BST by ORCHARD Nature 2013 imex curation Structural basis for the delivery of activated sialic acid into Golgi for sialyation. Structural basis for the delivery of activated sialic acid into Golgi for sialyation. Nature structural & molecular biology 2019 imex curation Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Nji E., Gulati A., Qureshi AA., Coincon M., Drew D. ddrew@dbb.su.se Accepted 2020-MAY-13 AT 13:24 BST AT 13:24 BST by KALPANAP Nature structural & molecular biology 2019 Only protein-protein interactions imex curation imex curation A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133836X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II. Structure of the maize photosystem I supercomplex with light-harvesting complexes I and II. Science (New York, N.Y.) 2018 imex curation Pan X., Ma J., Su X., Cao P., Chang W., Liu Z., Zhang X., Li M. xzzhang@ibp.ac.cn 09-May-2019: Contacted by IntAct-Help. Only protein-protein interactions imex curation maize Zea mays (Maize) Maize 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Pan X., Ma J., Su X., Cao P., Chang W., Liu Z., Zhang X., Li M. xzzhang@ibp.ac.cn Accepted 2018-JUL-23 AT 13:25 BST AT 13:25 BST by ORCHARD Science (New York, N.Y.) 2018 imex curation A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133842X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111396X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133840X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. Only protein-protein interactions maize Zea mays (Maize) Maize anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kroeger TS., Watkins KP., Friso G., van Wijk KJ., Barkan A. DIP original experiment: DIP-133841X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx A plant-specific RNA-binding domain revealed through analysis of chloroplast group II intron splicing. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Structural basis for the modular recognition of single-stranded RNA by PPR proteins. Nature 2013 imex curation Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yin P., Li Q., Yan C., Liu Y., Liu J., Yu F., Wang Z., Long J., He J., Wang HW., Wang J., Zhu JK., Shi Y., Yan N. DIP original experiment: DIP-255999X Nature 2013 IMEx Structural basis for the modular recognition of single-stranded RNA by PPR proteins. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hernandez JM., Feller A., Morohashi K., Frame K., Grotewold E. DIP original experiment: DIP-111397X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx The basic helix loop helix domain of maize R links transcriptional regulation and histone modifications by recruitment of an EMSY-related factor. wtf1_maize Protein WHAT'S THIS FACTOR 1, chloroplastic WTF1 ZEAMMB73_Zm00001d009618 protein protein maize Zea mays (Maize) Maize MDAKLLLPFPFAPAAATRSPKSLFLGAPLPPPPRPPPFPLRLRPRPAAVVAQAAVKRRKEAPFDTVIQRDKKLKLVLKLRNILVAQPDRVMSLRELGRFRRDLGLTRKRRLIALLRRFPGVFDVVEEGVYSLRFRLTPAAERLYLDELRLRNESEGLAVAKLRKLLMMSQEKRILIEKVAHLKHDLGLPPEFRDTVCLRYPQYFRVVRMDRGPALELTHWDPELAVSAAELAEEESRAREAEERNLIIDRPLKFNRVRLPKGLKLTRGEARRIARFKEMPYISPYADFSHLRSGSDEKEKHACGVVHEILSLTVEKRTLVDHLTHFREEFRFSQSLRGMIIRHPDMFYVSFKGDRDSVFLREAYKDSQLVEKNQLVLLKEKMRALVAVPRFPRRAAVGTGEEAEGMNGSLQSRDQVSDEEYDDEDEGLSDMEDLISELSGGKSDADYEWGDGWFGENDDSPPDFGDDEVKVAMKIADGSANGSAPVPVFPDGRPRERW DIP protein B6TTV8 original sequence version: 9 cfm3_maize CRM-domain containing factor CFM3, chloroplastic/mitochondrial CFM3 Protein CRM FAMILY MEMBER 3 protein protein maize Zea mays (Maize) Maize MAMASSPACHFRHPPRLRLLLPLSTSAPHPWLYSWSHPRQRGRLRAPPAALDLRPEPSPSSDSDDEDAVGASRSSGRSTMSLILSRLRRAGYSGEDPRAAAPPHPPRGSVEDVFRADDGVLPNARGGFDADDEERALGDARFPWERPMPPPEAAPRSARSPTWMAELTLPAAELRRLRHAAIRIKSRTKVGGAGVTREIVEKIKEKWKTEEVVRVKVSGTPALNMRLFHEILERKTGGLVIWRSGTSVSLYRGVDYDEPEPTKKSKKNSQSLAMDFPIKGSSNPSLLPTETANSVRDSNVALVSNAAKEELVVQAPEIKYEDEIDKLLDELGPRYTDWPGSDPLPVDADLLPANMPGYKPPFRVLPYGVRPSLSRRDTTNLRRLARGLPPHFALGRSRQLQGLANAMVKLWEKSSIAKIALKRGVQLTTSERMAEDIKKLTGGVMLSRNNEFIVFYRGKDFLSSELAEVLLERERLAKSLQDEEEARRKAASYFSSAETYAQPTVAGTLGETLEANSKYGTKHDENHADKMARTIEAARHADLVRKLEWKLSLAQKKMEKAERVLGKVETALRPTEDSRPPETITDEERFMFRKLGLRMKAFLLLGRRGVFDGTIENMHLHWKYRELVKILVKAKSFADVKRIALSLEAESGGILVSVDKVSKGYAIVVFRGKNYRRPSSLRPRNLLSKRKALARSIELQRHQALSRHFAKLNRKVERLKAELVQMEDVKEQGDEELYAKLDAAYSSDDEDMEDEDDEAYLKRFDNEVAGATADDDGSDDYTSAADEADYPDSDDEAGDCSEDEGEDDEDEAAAGVSDAGFHGEVVGFSSDTDRRNHDVNEY DIP protein A7XN92 original sequence version: 10 a7udm2_maize CFM2 protein protein maize Zea mays (Maize) Maize VGSTLDPSWATGDGEASSTSRQRRRGRGRDASGSPSAPPSAAELALPRDELRRLQGIGIRVRKRLKVGKAGITEGIVNGIHERWRNAEVVKLRCEDVWAMNMRRTHEILERKTGGLVIWRSGSTIILYRGTNYTYPYFHHSERVDSFLDKESSDQSNSGDEDETSSQHGSSHEKSSENPVVACAEQIHVGEGNSQTIEYLNQSLSREKDTNHPVSSIKRLVFDADEGNLDIRAGNPNEQHVRLQENTHPDSPNKFGPRDRSSLVAGVGSQNKFRLQLPGEVKLAEEADKLLDGLGPRFSGWWGYDPVPVDADLLPAIVPGYRRPFRLLPSGVPPKLTDREMTILRRLAHALPFHYALGRSSNLQGLAASMIKLWERCEVAKIALKRDAHNTDSELITEEVKELTGGTLLSRDKESIVFYRGKDFLPPAVSLAIEKRRKLGSSTIYKAKPGIEESMPTQNDSVLKVSSDVSVHVREEGTSVTENRAESLNTVAKDVETRLSQAIAEKAKAEKLIEELEKASPLSKAEVRETISEDERYMLRKVGLKMKQFLLLGRRGVFDGTIENMHLHWKYRELVKIICKEHRLEDVEYAARTLEAESGGILVAVEKVSKGHAIIVYRGKNYKRPSKLRPKTLLSKRDALKRSLENQRCKSLKVHVLKLSKNIDYLRDQMNSSYYHKDMHDPSVNSVTLQQQDEEMPEVAPMSSEPEVEKWTSVEIDRALDLTKSGVPVEDMQSKVCFNKLEDDSSATAGPCLTGSSIAASSYNLIRHQNQRSSTVTSSPDGRYEGAPSKVVDAPKLDAESLSVSPLRAAPLSNQERLVLRKQALQMKKRPVLSIGRNNAITGVAKTIKTHFKKHPLAIVNIKNRADGTPIQQLISELEEATGSVLVSRETNKVILYRGWGAEVAQKSSRESSTDEGEKEVISPQLLEAIRLECGLLPADSG DIP protein A7UDM2 original sequence version: 9 b4faw3_maize ZEAMMB73_Zm00001d034543 protein protein maize Zea mays (Maize) Maize MAMATQASAATRHLLAAAWAPAAKPRQLSSQLALPSSSSRGPAPLRASTEEAVEAPKGFVAPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNVNPIDVKFTGKATFD CDF24AB71961763C a6yrs1_maize rif1 100125653 ZEAMMB73_Zm00001d019922 protein protein maize Zea mays (Maize) Maize MDYGPSDSSGTDDDLPQLPHRSIRGSGRVSGNGRTIVPAGSYARAPTDMEAQIQQLEQEAYCSVLRAFKAQSDAITWEKEGLMTELRKELRVSDKAHRELLNKVNNDNIICSIREWRSTGGLQASMSNNPQPIHDPVPSPTTSGRKRQKTSQSVPALPAPPAMHSQQLATPTQPSSSTARKAVPPVPKGKKTKPGQKVPGGSAAKPMPSSAGPSGRGPHMNRNFPGGSAPEAQAQNVDPLVGRKVMSRWPEDNSFYEAVISDYNAETGLYVLVYDINTANETWEWVDLKEMGPEDIRWKEDDSGIDPVVYLRSRGAPSSGVRKPTGRGGPMPGSGRGRGLPKNMSRKDFPPPQNGVGKRSSDDIDILHTESLIKEVEKVFSVSNPDPQEVEKAKKALKEQEQSLIDAIARLAEASDGESDGLNRGRRNLYAGNQHQANYVDDMPVGDQADAM DIP protein A6YRS1 original sequence version: 6 arlc_maize Anthocyanin regulatory Lc protein LC protein protein maize Zea mays (Maize) Maize MALSASRVQQAEELLQRPAERQLMRSQLAAAARSINWSYALFWSISDTQPGVLTWTDGFYNGEVKTRKISNSVELTSDQLVMQRSDQLRELYEALLSGEGDRRAAPARPAGSLSPEDLGDTEWYYVVSMTYAFRPGQGLPGRSFASDEHVWLCNAHLAGSKAFPRALLAKSASIQSILCIPVMGGVLELGTTDTVPEAPDLVSRATAAFWEPQCPSSSPSGRANETGEAAADDGTFAFEELDHNNGMDDIEAMTAAGGHGQEEELRLREAEALSDDASLEHITKEIEEFYSLCDEMDLQALPLPLEDGWTVDASNFEVPCSSPQPAPPPVDRATANVAADASRAPVYGSRATSFMAWTRSSQQSSCSDDAAPAAVVPAIEEPQRLLKKVVAGGGAWESCGGATGAAQEMSGTGTKNHVMSERKRREKLNEMFLVLKSLLPSIHRVNKASILAETIAYLKELQRRVQELESSREPASRPSETTTRLITRPSRGNNESVRKEVCAGSKRKSPELGRDDVERPPVLTMDAGTSNVTVTVSDKDVLLEVQCRWEELLMTRVFDAIKSLHLDVLSVQASAPDGFMGLKIRAQFAGSGAVVPWMISEALRKAIGKR DIP protein P13526 original sequence version: 54 caf1p_maize CRS2-associated factor 1, chloroplastic CAF1 Chloroplastic group IIA intron splicing facilitator CRS2-associated factor 1 protein protein maize Zea mays (Maize) Maize MATARLPSRSFLSPAQQSYPRLPASVRLCLSHHEQPPTGPKRHRRAATSHPAFSAAARGRAKKIPIADTDEPAAGVRVTDRGISYRLDGAPFEFQYSYTEAPRARPVALREAPFMPFGPEATPRPWTGRKPLPKSRKELPEFDSFVLPAPGKKGVKPVQSPGPFLAGMEPRYQSVSREDILGEPLTKEEVSELVKGSLKSKRQLNMGRDGLTHNMLENIHSHWKRKRVCKIKCKGVCTIDMDNICHQLEEKVGGKVIHRQGGVIFLFRGRNYNYRTRPCFPLMLWKPVAPVYPRLVTKVPGGLTPDEATEMRTRGHQLPPICKLGKNGVYANLVNQVREAFEACDLVRVDCSGLNKSDCRKIGAKLKDLVPCILLSFEFEHILMWRGSDWKSSLPPLENSYEVTKVQESFSGKESNEKVTHSGNVLAQIELVSAATSHKNWNLDEGQEKFKDSTDSDMVLNSAKDVPALFHSTGISRTEPSADIPLEYSPLNPVCDIMDPSLNCRSIPTNNCESRALVEKSEHCPDDYNLEMKRKRNDGTKGTVVLNSGSKVEGLLCLLEQAIHSGRALVLSEDELADSDLVYEKSVAFTKSIPRRLVFENTRRKSSARRNVPDNHARTKTHLVENKMLSSPVENKFIVNGGSAMQTIDHGQEFLSDVVHQGTLRVDELAKLLA DIP protein Q84N49 original sequence version: 30 psai_maize Photosystem I reaction center subunit VIII psaI protein protein maize Zea mays (Maize) Maize MTDFNLPSIFVPLVGLVFPAIAMTSLFLYVQKNKIV 459A02A4E33486C5 a0a1d6hy75_maize ZEAMMB73_Zm00001d019518 protein protein maize Zea mays (Maize) Maize MASTNMASATSRFMLAAGVPTGSSGGRVNFASAPNRLGRRLVARADNEAAAAEAAEGEGAVATKPKAEKPPPIGPKRGAKVKILRRESYWYNGIGNVVTVDQDPNTRYPVVVRFNKVNYAGVSTNNYALDEVSEVK B1968E2C69771E48 b6u534_maize PSI-G 100285458 Photosystem I reaction center subunit V, chloroplastic ZEAMMB73_Zm00001d005996 protein protein maize Zea mays (Maize) Maize MAATSTAAAVLSPPSVAGLRLAPSPGRARVSFRAAPAPARRSVAARAELSSALVISLSTGVSLFLGRFVFFNFQRENVAKQVPAQNGKTHFDAGDERAKEFAALLKSNDPVGFNLVDVLAWGSLGHIVAYYILATSSNGYDPNFF 319E021E69374E5D b6szr1_maize Chlorophyll a-b binding protein, chloroplastic protein protein maize Zea mays (Maize) Maize MASVTARAPVAALRPSASLKSSSSSAAAFLGHSSRLGRTATASPTRRSLKAEAKGEWLPGLPSPAYLDGSLPGDNGFDPLGLAEDPENLRWYVQAELVNGRWAMLGVAGMLIPEVLTKAGLINAPQWYDAGKSEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGSVFNPLNFAPTLEAKEKELANGRLAMLAFLAFLIQHNVTGKGPFDNLLQHLSDPWHNTIIQTLSG 2A93954444AA667A b6stt2_maize PSI subunit V protein protein maize Zea mays (Maize) Maize MATAYAPMASQVMKSSLVVHSRPRGLSGAAALTRRPGRFTVKAIQPEKATYQVVQPINGDPFIGSLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGVEVGLAHGYLLVGPFALTGPLRSTPVHGQAGALGAAGLVAILSVCLTMYGVASFNEGDPSTAPSLTLTGRKKEADKLQTSDGWAKFTGGFFFGGISGVLWAYFLLYVLDLPYFFK 1561080BAB9C8D51 b6sri3_maize PSI-F ZEAMMB73_Zm00001d034283 protein protein maize Zea mays (Maize) Maize MAALAAASTAAFAAKPRARLSVACSAATGDSSSVSLASSVKTFSAALALSSVLLSSAATSPPPAAADIAGLTPCKESKAFAKREKNSIKKLTASLKKYAPDSAPALAINATIEKTKRRFENYGKFGLLCGADGLPHLIVSGDQRHWGEFVTPGLLFLYIAGWIGWVGRSYLIAISGEKKPAMREIIIDVELATRLLPRGFIWPVAAYRELINGDLVVDDKDIGYY FA1C31941EFB25D8 b6t892_maize Chlorophyll a-b binding protein, chloroplastic 100282512 ZEAMMB73_Zm00001d021906 protein protein maize Zea mays (Maize) Maize MALVSASSSSTTAVAALPRNGQQRASSSLFSSSSSSSFLVGKTLLRQAEAARPSFAVRAAADSDRPIWFPGSTPPPWLDGSLPGDFGFDPWGLGSDPESLRWNVQAELVHCRWAMLGAAGIFIPEFLTKIGVLNTPFWYTAGEQQYFTDTTTLFIIELILIGWAEGRRWADIIKPGSVNTDPIFPSNKLTGTDVGYPGGLWFDPLGWGSGSPEKIKELRTKEIKNGRLAMLAVMGAWFQAEYTGTGPIDNLFAHLADPGHATIFQAFTPK D95D750668F249E0 b6tws6_maize 100284718 ZEAMMB73_Zm00001d027886 protein protein maize Zea mays (Maize) Maize MSVLTCVIESMGSSCSRSHSFDEAEAAENAKSADIDRRILQETKAEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYEGAKELAQVEPDSSKYVLSPDNQEIGEKLSEIGARLEYPSLNKERVQDVRKLWQDPAIQETYSRGSILQVPDCAQYFMENLDKLSEEDYVPTKEDVLHARVRTNGVVETQFSPLGESKRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETKELFDWVLKQRCFEKTSFMLFLNKFDIFERKIQKVPLSVCEWFKDYQPTAPGKQEVEHAYEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT 0DBB001B06065E06 b6t1h1_maize Chlorophyll a-b binding protein, chloroplastic protein protein maize Zea mays (Maize) Maize MAASALHQTTSFLGQALVARAAGVDAGDRITMRRTVKSVPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILAKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTAAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGN 57E9564E6FEB8411 b6sqz7_maize protein protein maize Zea mays (Maize) Maize MHLLASCCFTRGSRVSARNPLMSRNLERNGRITCMTFPRDWLRRDLSVIGFGLIGWMGPSSVPAINGNSLTGLFFSSIGQELAHFPTPPPVTSQFWLWLVTWHLGLFIVLTFGQIGFKGRTEDYFEK B9C455F60D928216 psaj_maize Photosystem I reaction center subunit IX psaJ PSI-J protein protein maize Zea mays (Maize) Maize MRDIKTYLSVAPVLSTLWFGALAGLLIEINRLFPDALSFPFF DD29FAE6CAB485F6 ppr10_maize Pentatricopeptide repeat-containing protein 10, chloroplastic PPR10 ZEAMMB73_Zm00001d036698 protein protein maize Zea mays (Maize) Maize MEATGRGLFPNKPTLPAGPRKRGPLLPAAPPPPSPSSLPLDSLLLHLTAPAPAPAPAPRRSHQTPTPPHSFLSPDAQVLVLAISSHPLPTLAAFLASRRDELLRADITSLLKALELSGHWEWALALLRWAGKEGAADASALEMVVRALGREGQHDAVCALLDETPLPPGSRLDVRAYTTVLHALSRAGRYERALELFAELRRQGVAPTLVTYNVVLDVYGRMGRSWPRIVALLDEMRAAGVEPDGFTASTVIAACCRDGLVDEAVAFFEDLKARGHAPCVVTYNALLQVFGKAGNYTEALRVLGEMEQNGCQPDAVTYNELAGTYARAGFFEEAARCLDTMASKGLLPNAFTYNTVMTAYGNVGKVDEALALFDQMKKTGFVPNVNTYNLVLGMLGKKSRFTVMLEMLGEMSRSGCTPNRVTWNTMLAVCGKRGMEDYVTRVLEGMRSCGVELSRDTYNTLIAAYGRCGSRTNAFKMYNEMTSAGFTPCITTYNALLNVLSRQGDWSTAQSIVSKMRTKGFKPNEQSYSLLLQCYAKGGNVAGIAAIENEVYGSGAVFPSWVILRTLVIANFKCRRLDGMETAFQEVKARGYNPDLVIFNSMLSIYAKNGMYSKATEVFDSIKRSGLSPDLITYNSLMDMYAKCSESWEAEKILNQLKCSQTMKPDVVSYNTVINGFCKQGLVKEAQRVLSEMVADGMAPCAVTYHTLVGGYSSLEMFSEAREVIGYMVQHGLKPMELTYRRVVESYCRAKRFEEARGFLSEVSETDLDFDKKALEAYIEDAQFGR DIP protein B8Y6I0 original sequence version: 28 rnc1_maize Ribonuclease III domain-containing protein RNC1, chloroplastic RNC1 Zm.27802 Chloroplast ribonuclease III domain protein protein protein maize Zea mays (Maize) Maize MGPPAMAFQALTLTPLPFSLHSSSRRVRVLAVAADQTPPPAPPSEPANSPSRLLRELAQRKKAVSPKKKHPPRRFILKPPLDDERLTRRFLSSPQLSLKALPLLSSCLPSAPLSTADRTWMDEYLLEAKQALGYPLAPSETLGEGDDCPARHFDVLFYLAFQHLDPSSERTRMRHVRNGHSRLWFLGQYVLELAFCEFFLQRYPRESPGPMRERVFALIGKKVLPRWLKAASLHNLVFPYDDLDKMIRKDREPPSKAVFWAIFGAIYLCFGMPEVYRVLFEAFGMDPDDESCQPKLRRQLEDVDYVSVEFEKRQLTWQDVAAYRPPPDALFAHPRLFRACVPPGMHRFRGNIWDFDSRPKVMTTLGYPLPMNDRIPEITEARNIELGLGLQLCFLHPSKHKFEHPRFCYERLEYVGQKIQDLVMAERLLMKHLDAPGRWLAEKHRRTLMNKYCGRYLRDKHLQHYIIYGETVQDRFEHNRRLRNPSTTSVQQALHGLAYCVYGKPDVRRLMFEVFDFEQVQPKAV DIP protein A6YSL1 original sequence version: 17 a0a059q6u2_maize Photosystem I P700 chlorophyll a apoprotein A2 psaB PSI-B PsaB protein protein maize-1 Zea mays subsp. mays MELRFPRFSQGLAQDPTTRRIWFGIATAHDFESHDDITEERLYQNIFASHFGQLAIIFLWTSGNLFHVAWQGNFESWIQDPLHVRPIAHAIWDPHFGQPAVEAFTRGGAAGPVNIAYSGVYQWWYTIGLRTNEDLYTGALFLLFLSTLSLIGGWLHLQPKWKPSLSWFKNAESRLNHHLSGLFGVSSLAWTGHLVHVAIPGSRGEYVRWNNFLDVLPYPQGLGPLLTGQWNLYAQNPDSSNHLFGTTQGAGTAILTLLGGFHPQTQSLWLTDIAHHHLAIAFIFLIAGHMYRTNFGIGHSIKDLLEAHTPPGGRLGRGHKGLYDTINNSIHFQLGLALASLGVITSLVAQHMYSLPAYAFIAQDFTTQAALYTHHQYIAGFIMTGAFAHGAIFFIRDYNPEQNEDNVLARMLDHKEAIISHLSWASLFLGFHTLGLYVHNDVMLAFGTPEKQILIEPIFAQWIQSAHGKTTYGFDILLSSTNGPAFNAGRNIWLPGWLNAVNENSNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYSFPCDGPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAWAHERTPLANLIRWRDKPVALSIVQARLVGLAHFSVGYIFTYAAFLIASTSGKFG 1D8165BBEDBA608F b6suc4_maize Chlorophyll a-b binding protein, chloroplastic ZEAMMB73_Zm00001d046786 protein protein maize Zea mays (Maize) Maize MAAQALLSGRQLLGRPVQSAVSRSSARKAPFVVRASSSPPAKQGADRQLWFASKQSLSYLDGTLPGDYGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRYAMLGAVGAIAPEIFGKMGIIPPETALPWFKTGVIPPAGTYNYWADSYTLFVFNMALMGFAEHRRLQDWYNPGSMGKQYFLGLEKFLAGSGDPSYPGGPLFNPLGFGKTEKEMNELKLKEIKNGRLAMLAILGYFIQGLVTGVGPFQNLLDHLADPVNNNVLTSLKFH 14BC4D3C1CA6BC8E b4fz94_maize 100274139 ZEAMMB73_Zm00001d046060 protein protein maize Zea mays (Maize) Maize MQWYLVAALLTILTSSQGILTTLSQSNGKYNYDYATIPFLAELFKLSVSGFFLWKECHSSSPPRMTKEWRSVRLYVVPSVIYLIHNNVQFATLTYVDPSTYQIMGNLKIVTTGILFRLVLKRKLSNIQWMAIVLLAVGTTTSQVKGCGDSPCDSLFSAPLEGYLLGILSACLSALAGVYTEYLMKKNNDSLYWQNVQLYTFGVIFNMGWLIYGDFKAGFELGPWWQRLFNGYSITTWMVVFNLGSTGLLVSWLMKYSDNIVKVYSTSMAMLLTMVLSIYLFSVKATIQLFLGIIICIISLQMYFMPVHMLIELPQTLPVTSK 32993E7896678088 psah_maize Photosystem I reaction center subunit VI, chloroplastic PSAH Light-harvesting complex I 11 kDa protein protein protein maize Zea mays (Maize) Maize MASLAAVSVKPVAIKGLAGSSISGRKLAVARPSARSIRRPRAAAVVAKYGDKSVYFDLDDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGGGSLLAYVSASASPDLLPIKKGPQEPPQPGPRGKI C8E9540210026B96 caf2p_maize CRS2-associated factor 2, chloroplastic CAF2 Chloroplastic group IIA intron splicing facilitator CRS2-associated factor 2 protein protein maize Zea mays (Maize) Maize MPPPPPQRPASSHVGRANLFSASPPPLSNRRYPHHRSLPLPPVSPRRRDPKKHSQQPSQEEPTDSGPTRTVTTNPAFRAAHLRTAYRKPVPPAAAAGEGEALLAADPTDAASGRAVVVGPSGLSFRLPGAPFDFQFSYSEAPRAPPLAIREPAFLPFAPPTMPRPWTGKAPLLTKEEKARRRGVRLHTPLGQETPQTVSAHGIMMEVRERRKMDLARVSPGDGRSREEVLGEPLTPSEVRALVKPHISHNRQLNIGRDGLTHNMLEMIHCHWRRQEICKVRCRGVPTVDMKNLCYHLEEKSGGKVIHRVGGVVFLYRGRHYDPKTRPRYPLMLWKPATPVYPKLIKEAPDGFTKEEADEMRRKGRDLLPICKLAKNGIYITLVKDVRDAFEGSDLVKIDCEGLNPSDYKKIGAKLRDLVPCVLLSFDDEQILMHRGKEWKSRYSKPLTLIPKVPKNNLAMTSVMNSSDEVSDANTQVAIREVLRPKMFKLWKSAVDSSLALLLDDAEANNLTPDSLLTLVEEFSVTSQAVEHSFPALLVTNGDASTDSLSAEYMNDEPETSVAGNEEGQLEQSPDLRDDEHFDVDMFERLESSVPLGSLPIDSMIERLNSE DIP protein Q84N48 original sequence version: 27 fea2_maize Leucine-rich repeat receptor-like protein FASCIATED EAR2 CLAVATA2-like protein ZEAMMB73_546581 FEA2 protein protein maize Zea mays (Maize) Maize MLTATPLPHQLLATFLLVLASATQPAVPASTDRAALLAFRASLSPPSRAALSSWSGPLSPSWLGVSLHPATAPAPSVTTPSVAELSLRGLNLTGVIPAAPLALLRRLRTLDLSANALSGELPCSLPRSLLALDLSRNALSGAVPTCLPSSLPALRTLNLSANFLRLPLSPRLSFPARLAALDLSRNAISGAVPPRIVADPDNSALLLLDLSHNRFSGEIPAGIAAVRSLQGLFLADNQLSGDIPPGIGNLTYLQVLDLSNNRLSGSVPAGLAGCFQLLYLQLGGNQLSGALRPELDALASLKVLDLSNNKISGEIPLPLAGCRSLEVVDLSGNEISGELSSAVAKWLSLKFLSLAGNQLSGHLPDWMFSFPLLQWLDLSSNKFVGFIPDGGFNVSEVLNGGGGQGTPSESVLPPQLFVSASVDTVSWQLDLGYDVQATTGIDLSGNELCGEIPEGLVDMKGLEYLNLSCNYLAGQIPAGLGGMGRLHTLDFSHNGLSGEVPPGIAAMTVLEVLNLSYNSLSGPLPTTKFPGALAGNPGICSGKGCSENARTPEGKMEGSNHRGWLGGWHGENGWVSLGAFCISTMTSFYVSLATLLCSSNARNFVFRPVRVEY 554A8A76C878A977 psac_maize Photosystem I iron-sulfur center psaC frxA 9 kDa polypeptide PSI-C Photosystem I subunit VII PsaC protein protein maize Zea mays (Maize) Maize MSHSVKIYDTCIGCTHCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY 680844EC98E133BF b6tr16_maize PSI-K 100286020 Photosystem I subunit X ZEAMMB73_Zm00001d018797 protein protein maize Zea mays (Maize) Maize MASQLSAAVPRFHGLRGYAAPRSAVAALPSVRVGRKRSSSQGIRCDYIGSATNLIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARDSGLQTGDPAGFTLADTLACGAVGHILGVGIVLGLKNTGALDQIIG 6098CF117A062910 b6ssn3_maize Chlorophyll a-b binding protein, chloroplastic 100281791 ZEAMMB73_Zm00001d015385 protein protein maize Zea mays (Maize) Maize MVMASSSGLRSCSAVGVPSLLAPSSRSGRLAPFCANATTSGRVTMSAEWMPGQPRPAHLDGSSPGDFGFDPLGLATVPENFERFKESEVYHCRWAMLAVPGILVPEALGLGNWVKAQEWAAVPGGQATYLGAPVPWGTLPTILVIEFVAIAFAEHQRTMEKDPEKKKYPGGAFDPLGFSKDPAKFEEYKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLASHLADPWHNNIGDIIIPRSISP FECA367B695C20D9 cb21_maize Chlorophyll a-b binding protein 1, chloroplastic CAB1 LHCII type I CAB-1 protein protein maize Zea mays (Maize) Maize MAASTMAISSTAMAGTPIKVGSFGEGRITMRKTVGKPKVAASGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN 4165FADFE6727853 psaa_maize Photosystem I P700 chlorophyll a apoprotein A1 psaA ps1a1 PSI-A PsaA protein protein maize Zea mays (Maize) Maize MIIRSSEPEVKIAVDRDPIKTSFEEWARPGHFSRTIAKGNPDTTTWIWNLHADAHDFDSHTGDLEEISRKVFSAHFGQLSIIFLWLSGMYFHGARFSNYEAWLSDPTHIGPSAQVVWPIVGQEILNGDVGGGFRGIQITSGFFQIWRASGITSELQLYCTAIGALIFASLMLFAGWFHYHKAAPKLAWFQDVESMLNHHLAGLLGLGSLSWAGHQIHVSLPINQFLDAGVDPKEIPLPHEFILNRDLLAQLYPSFAEGATPFFTLNWSKYAEFLSFRGGLDPITGGLWLSDIAHHHLAIAILFLIAGHMYRTNWGIGHGLKDILEAHKGPFTGQGHKGLYEILTTSWHAQLSLNLAMLGSTTIVVAHHMYSMPPYPYLATDYGTQLSLFTHHMWIGGFLIVGAAAHAAIFMVRDYDPTTRYNDLLDRVLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMSALGRPQDMFSDAAIQLQPIFAQWIQNIHAGAPGVTAPGATTSTSLTWGGGELVAIGGKVALLPIPLGTADFLVHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSAWDHVFLGLFWMYNSISVVIFHFSWKMQSDVWGTISDQGIVTHITGGNFAQSSITINGWLRDFLWAQASQVIQSYGSSLSAYGLFFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPATQPRALSIIQGRAVGVTHYLLGGIATTWAFFLARIIAVG E7EAEDFB9EE61EBC crs1_maize Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic CRS1 Chloroplastic RNA splicing factor 1 Protein CHLOROPLAST RNA SPLICING 1 protein protein maize Zea mays (Maize) Maize MAPPPLPLFSPSLKAPPPPPWLHGSSTQSRDSAPPVPPLPAEATPSKFRIDSPKPAPARKNTKTAAKPLTAGVPGGRTHRAVLGIIRRVRSLELSDAPSPNSVHTSNSGAAAAAFHLTIELSPPREPGQYVVEKEKSRAVPWAAARDEGLKVALRREKKPREPTRAETELETHELRRLRRLARGIGRWARAKKAGVTDEVVKEVRREWASGEELAAVRIVEPLRRSMDRAREILEIKTGGLVVWTKGDMHFVYRGSKYQQNAKHSHTFLTNVHKDDAFQENDQSICGQKDEEPVKGTLYEREVNRLLDTLGPRFVDWWWDTPLPVDADLLPEFVPGSKTPYRLCPPGVRPTLADEELTYLRKLARLLPTHFALGRNTRLQGLAAAILKLWEKSLIAKIAVKIGIQNTNNEQMAWNLKHLTGGTVILRNKDFIILYRGKDFLPGGVAQTVIQREAQVHDEQVKEEEARLKAVDSLQMVGELSEESSLGTFREYQGFHAKFVHENTENSNTMIELEAEKYRLEKELKDHEWKLSVLNKKIERSNQALAKLHSSWSPSEQSADREHLTEEEKIMFRRIGRKMDGLVLLGRRGIFDGVIEEIHQHWKHKEVVKVITKQNQTRQIMYAASLLEVETGGILIAVEKLTTSHAIILYRGKNYRRPAKSSFSNLLTKREALRRSIEVQRRGSMKYFVRERQKSILELKRKLRYVTRQIRYRTP DIP protein Q9FYT6 original sequence version: 31 b6txs5_maize protein protein maize Zea mays (Maize) Maize MNSSFIGLKPAAAAAQATAAASSPMKQQQVQVAPQSRRAALLGLAAVFAVTATTAGSAKAGVFDEYLEKSKANKELNDKKRMATSAANFARAYTVEFGSCQFPYNFTGCQDLAKQKKVPFLSDDLEIECEGKEKFKCGSNVFWKW 89FBD3E5527459C7 rif1-rif1-1 21 26 unspecified role unspecified role prey prey Binding region 49-114 Binding region 49-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role bait bait Binding region 49-114 Binding region 49-114 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction lc-rif1-1 8 27 unspecified role unspecified role bait bait Binding region 411-462 Binding region 411-462 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction lc-rif1-2 17 27 unspecified role unspecified role bait bait Rgion 411-610 Rgion 411-610 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 26 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction lc-rif1-3 3 27 unspecified role unspecified role bait bait Rgion 411-610 Rgion 411-610 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 26 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction caf1-b6ttv8_maize-1 5 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association cfm3-b6ttv8_maize-1 16 41 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 23 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association caf2-b6ttv8_maize-1 9 23 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 24 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 41 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association cfm2-caf2-1 19 46 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 24 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association rnc1-b6ttv8_maize-1 18 23 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 41 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association b6ttv8_maize-rnc1-1 7 22 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 41 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction caf2-b6ttv8_maize-2 14 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize physical association physical association caf1-b6ttv8_maize-2 6 23 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 41 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 22 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association b6ttv8_maize-caf1-1 10 23 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 53 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 41 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 46 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 28 unspecified role unspecified role prey prey maize Zea mays (Maize) Maize 22 unspecified role unspecified role bait bait maize Zea mays (Maize) Maize association association b6ttv8_maize-rnc1-2 1 22 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 41 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction ppr10-1 2 40 unspecified role unspecified role unspecified role unspecified role Region 37-786 Region 37-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ppr10-2 11 40 unspecified role unspecified role unspecified role unspecified role Region 61-786 Region 61-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction ppr10-3 20 40 unspecified role unspecified role unspecified role unspecified role Region 69-786 Region 69-786 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction 100191984-100281791 15 48 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 37 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 51 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 38 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 54 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 33 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 49 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 39 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 29 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 45 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 31 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 34 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 30 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 25 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 42 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 52 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 32 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 43 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 35 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize 50 unspecified role unspecified role neutral component neutral component purified purified maize Zea mays (Maize) Maize physical association physical association Figure 1 100284718-fea2-1 12 47 unspecified role unspecified role prey prey native native 36 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed YFP tag YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 3D, Extended Data Fig 5E 100274139-1 4 44 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction Fig. 1, Table 1, Supplementary Figure 2 100274139-2 13 44 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified strep tag strep tag strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Supplementary Figure 1a