MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic. A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic. FEBS J. (1742-464X) 2014 imex curation Zurga S., Pohleven J., Renko M., Bleuler-Martinez S., Sosnowski P., Turk D., Künzler M., Kos J., Sabotič J. jerica.sabotic@ijs.si 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro bn-page blue native page bn-page weight by staining molecular weight estimation by staining weight by staining jerica.sabotic@ijs.si Accepted 2014-JUN-12 by LUANA 2014 imex curation A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic. A novel β-trefoil lectin from the parasol mushroom (Macrolepiota procera) is nematotoxic. FEBS J. (1742-464X) 2014 imex curation Zurga S., Pohleven J., Renko M., Bleuler-Martinez S., Sosnowski P., Turk D., Künzler M., Kos J., Sabotič J. jerica.sabotic@ijs.si 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined jerica.sabotic@ijs.si Accepted 2014-JUN-12 by LUANA 2014 imex curation f6kmv5_macpc protein protein macpc Macrolepiota procera MSTQVSSGQTYKITNVKAGTVIDLSGEDNKSIIGYPYHSGKNQQWTFNWTGKAWTLRSASSGSYLGIEGTPADGTRLVAVNDPFEWHIWRDEANENAFRIFVPFTNYNLDLSGYGDTTPGTPVQLWWTWEGLHQTWTIDRP C3BFEFFBF7BEAFB7 f6kmv5 1 rMpL 3 weight by staining molecular weight estimation by staining weight by staining weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified physical association physical association f1c f6kmv5-1 1 rMpL 3 weight by staining molecular weight estimation by staining weight by staining weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified F6KMV5:p.[Ile22Arg;Gly113Ser;Thr128His;Leu132Asn] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I R certain certain sequence position certain certain certain sequence position certain T H certain certain sequence position certain certain certain sequence position certain G S certain certain sequence position certain certain certain sequence position certain L N Fri Jul 22 11:00:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'ile22arg,thr128his,gly113ser,leu132asn' Wed May 02 17:45:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile22arg,gly113ser,thr128his,leu132asn' Tue Jun 30 16:05:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile22Arg;Gly113Ser;Thr128His;Leu132Asn]' physical association physical association f1c Non-mutated lectins (nMpL, rMpL) exhibited a prominent band at 35-40 kDa, indicating the presence of a dimer (Figure 1C, lanes 1 and 2), similarly to rCNL (Figure 1C, lane 8), which is known to form a dimer [10]. Interestingly, mutants D22R and GAMMA showed the presence of a higher oligomer, possibly a hexamer. f6kmv5-1 1 rMpL 3 weight by staining molecular weight estimation by staining weight by staining weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified F6KMV5:p.Ile22Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I R Wed May 02 15:36:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile22arg' Tue Jun 30 20:10:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile22Arg' physical association physical association f1c Non-mutated lectins (nMpL, rMpL) exhibited a prominent band at 35-40 kDa, indicating the presence of a dimer (Figure 1C, lanes 1 and 2), similarly to rCNL (Figure 1C, lane 8), which is known to form a dimer [10]. Interestingly, mutants D22R and GAMMA showed the presence of a higher oligomer, possibly a hexamer. f6kmv5-1 2 rMpL 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association f6 t2