IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst. TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst. eLife 2015 imex curation Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. usually I would add competition expts with "zero" point - no competitor - but in these instances there is only a reaction/dissociation in presence of TAPBPR - or I have (probably) not done these correctly... "Peptide-receptive" HLA-A*02:01 and HLA-B*08:01 (HLA-B*08:01fos or HLA-B*08:01fos T134K molecules) were obtained by exposing the monomeric MHC class I complexes with UV labile peptides(for HLA-A*02:01= KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid and for HLA-B*08:01 =FLRGRAjGL) to ∼360 nm light for 20 min at 4°C ('UV exposed'). MHC class I molecules were subsequently allowed to bind to fluorescent peptides and dissociation of the fluorescent peptide was subsequently followed after the addition of excess non-labelled competitor peptide in the absence or presence of TAPBPR or other proteins. HLA-B*08:01fos or HLA-B*08:01fos T134K molecules HLA A*0201/HLA B:0801:-DNA encoding the "ER luminal domains" was used; but the residue numbering of these domains is not stated;it has been assumed to be the domains before the transmembrane region. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Accepted 2017-MAY-03 AT 09:56 BST AT 09:56 BST by ORCHARD eLife 2015 imex curation I have replaced the Plant protein with Q6DPU2:- I have used this entry rather than D9J353, as it was an exact match to the sequence given in the Nature article, as in the Data-Proc comment I added - also a Reviewed entry - so presumably will not be "lost" TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst. TAPBPR alters MHC class I peptide presentation by functioning as a peptide exchange catalyst. eLife 2015 imex curation Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk 8-Jun-2017: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Hermann C., van Hateren A., Trautwein N., Neerincx A., Duriez PJ., Stevanović S., Trowsdale J., Deane JE., Elliott T., Boyle LH. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. "Peptide-receptive" HLA-A*02:01 and HLA-B*08:01 were obtained by exposing the monomeric MHC class I complexes with UV labile peptides(for HLA-A*02:01= KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid and for HLA-B*08:01 =FLRGRAjGL) to ∼360 nm light for 20 min at 4°C ('UV exposed'). The binding of fluorescent peptides to UV-exposed MHC class I was monitored in the absence and the presence of TAPBPR or I285K mutant. The Uniprot entry for the UV-labile peptide KILGFVFjV (j represents 3-amino-3-(2-nitro) phenyl-propionic acid) -UniProt Q6DPU2, influenza Matrix 1 epitope; this was derived from the sequence GILGFVFTL - see PMID:17406393 HLA A*0201/B0801:-DNA encoding the "ER luminal domains" was used; but the residue numbering of these domains is not stated;it has been assumed to be the domains before the transmembrane region. Mapping is given in relation to UniProt full length molecules -including signal sequences- as signal peptide lengths given in this publication sometimes differ from those stated in Uniprot. lhb22@cam.ac.uk Accepted 2017-MAY-03 AT 09:56 BST AT 09:56 BST by ORCHARD eLife 2015 imex curation I have replaced the Plant protein with Q6DPU2:- I have used this entry rather than D9J353, as it was an exact match to the sequence given in the Nature article, as in the Data-Proc comment I added - also a Reviewed entry - so presumably will not be "lost" b2mg_human Beta-2-microglobulin B2M CDABP0092 HDCMA22P protein protein human Homo sapiens Human MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM DIP protein P61769 original sequence version: null DIP protein P61769 original sequence version: 138 DIP protein P61769 original sequence version: 134 DIP protein P61769 original sequence version: 135 DIP protein P61769 original sequence version: 116 DIP protein P61769 original sequence version: 60 DIP protein P61769 original sequence version: 79 DIP protein P61769 original sequence version: 87 DIP protein P61769 original sequence version: 93 DIP protein P61769 original sequence version: 94 DIP protein P61769 original sequence version: 91 DIP protein P61769 original sequence version: 106 DIP protein P61769 original sequence version: 111 AFD2DBEF07DCEF27 tpsnr_human Tapasin-related protein TAPBPL TAP-binding protein-like TAP-binding protein-related protein Tapasin-like protein protein human Homo sapiens Human MGTQEGWCLLLCLALSGAAETKPHPAEGQWRAVDVVLDCFLAKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVTCEISRYFLQMTETTVKTAAWFMANMQVSGGGPSISLVMKTPRVTKNEALWHPTLNLPLSPQGTVRTAVEFQVMTQTQSLSFLLGSSASLDCGFSMAPGLDLISVEWRLQHKGRGQLVYSWTAGQGQAVRKGATLEPAQLGMARDASLTLPGLTIQDEGTYICQITTSLYRAQQIIQLNIQASPKVRLSLANEALLPTLICDIAGYYPLDVVVTWTREELGGSPAQVSGASFSSLRQSVAGTYSISSSLTAEPGSAGATYTCQVTHISLEEPLGASTQVVPPERRTALGVIFASSLFLLALMFLGLQRRQAPTGLGLLQAERWETTSCADTQSSHLHEDRTARVSQPS FA39C335FC22960E ebna3_ebvg Epstein-Barr nuclear antigen 3 Epstein-Barr nuclear antigen 3A BLRF3-BERF1 EBNA3 protein protein ebvg Epstein-Barr virus (strain B95-8) Human herpesvirus 4 MDKDRPGDPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDSSSEKEAEDAQLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLRTLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYAMAIRQAIRDRRRNPASRRDQAKWRLQTLAAGWPMGYQAYSSWMYSYTDHQTAPTFVQLQATLGCTGGRRCHVTFSAGTFKPPRCTPGDRQWLYVQSSVGNIVQSCNPRYSIFFDYMAIHRSLTKIWEEVLTPDQRVSFMEFLGFLQRTDLSYIKSFVSDALGTTSIQTPWIDDNSSTETAQAWNAGFLRGRAYGLDLLRTEGEHVEGATGETREESEDTESDGDDEDLPCIVSRGGPKVKRPPIFIRRLHRLLLMRAGKRTEQGKEVLEKARGSTYGTPRPPVPKPRPEVPQSDETATSHGSAQVPEPPTIHLAAQGMAYPLHEQRGMAPCPVAQAPHTPLPPVSPGDQLPGVSSDGRVACAPVPAPAGPIVRPWEPSLTQAAGQAFAPVRPQHMPVEPVPVPTVALERPVYPKPVRPAPPKIAMQGPGETSGIRRARERWRPAPWTPNPPRSPSQMSVRDRLARLRAEAQVKQASVEVQPPQVTQVSPQQPMEGPGAPFSQVADVVHTPGVPAMQPQYFDLPLIQPISQGAPVAPLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFLPQQPMEGPLVPEQWMFPGAALSQSVRPGVAQSQYFDLPLTQPITHGAPAAHFLHQPPMEGPWVPEQWMFQGAPPSQGTDVVQHQLDALGYPLHALNHPGVPVSPAVNQYHLSQAAFGLPIDEDESGEGSDTSEPCEALDLSIHGRPCPQAPEWPVQGEGGQDATEVLDLSIHGRPRPRTPEWPVQGESGQNVTDHEPRRVVVSAIVHMCQDDEFPDLQDPPDEA DABB76CCC45C2E5C gag_hv1w2 Gag polyprotein gag Pr55Gag protein protein isolate WMJ22 Human immunodeficiency virus type 1 group M subtype B HIV-1 MGARASVLSGGELDKWEKIRLRPGGKKKYRLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEKKDTKEALDKIEEEQNKCKKKAQQAAADTGNSSQVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPTTIMMQKGNFRNQRKT F965F184AD63ECCD 1b08_human_deprecated MHC class I antigen B*8 HLA-B HLAB protein protein human Homo sapiens Human MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA This protein is not up-to-date anymore with the uniprot protein because of feature conflicts. 9B2A9760021680DF b2m-c-12 1 6 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 16:27:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 17 12 14 physical association physical association 4 A/B HLA-B*0801 allele TAPBPR did not significantly enhance dissociation of two additional peptides, ELRSRK*WAI and FLRGRK*YGL from HLA-B*08:01. (Figs 4 C/D) b2m-gag-1 2 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q3KST2:p.Tyr331Xaa mutation mutation certain certain sequence position certain certain certain sequence position certain Y X Wed May 02 20:20:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr331xaa' Tue Jun 30 17:37:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr331Xaa' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component mature_protein sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 competitor competitor competitor neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tamra_tag rhodamine label rhodamine label certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range c_terminal_leucine_zipper tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range p.Thr158Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T K Wed May 02 16:16:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr158lys' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component luminal_domain sufficient to bind sufficient binding region sufficient to bind range range range range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n_terminal_signal tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 26 29 34 physical association physical association 4 E HLA-B*0801 allele The enhancement of binding by TAPBPR was only observed when using the EIYK*RWIIL peptide.