IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Cell (0092-8674) 2010 imex curation Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Cell (0092-8674) 2010 imex curation Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1. Cell (0092-8674) 2010 imex curation Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu 21-Dec-2010: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Liu H., Juo ZS., Shim AH., Focia PJ., Chen X., Garcia KC., He X. Viral constructs are interesting here - paper infers viral protein is same throughout, PDB (and I've checked it back to the header file) suggest they vary. I've stuck with the PDB constructs throughout. Superdex-200 x-he@northwestern.edu Accepted 2010-Not a month!-2 by JYOTI. 21-Dec-2010: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation plxc1_human Plexin-C1 PLXNC1 VESPR Virus-encoded semaphorin protein receptor protein protein human Homo sapiens Human MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVASGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLGNLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTAESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIKEETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQRCTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSIPTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTSTCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQNITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQYREDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQKQLLHVKVLFDEKKKCKWM EA0CE5519BEF925D sem7a_human Semaphorin-7A SEMA7A CD108 SEMAL Semaphorin-L Semaphorin-K1 John-Milton-Hargen human blood group Ag JMH blood group antigen CDw108 protein protein human Homo sapiens Human MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH AD3ABE56B5EBE194 sema_ectvm Semaphorin-like protein 139 EVM139 SEMA protein protein ectvm Ectromelia virus (strain Moscow) MIPLLFILFYFTNCIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTNNNNYITTSIKVEDTLVCGTNNGNPKCWKIDGSEDPKYRGRGYAPYQNSKVTIISHNECVLSDINISKEGIKRWRRFDGPCGYDLYTADNVIPKDGVRGAFVDKDGTYDKVYILFTDTIDTKRIVKIPYIAQMCLNDEGGPSSLSSHRWSTFLKVELECDIDGRSYRQIIHSKAIKTDNDTILYVFFDSPYSKSALCTYSMNAIKHSFSTSKLGGYTKQLPSPAPGICLPAGKVVPHTTFDIIEQYNELDDIIKPLSQPIFEGPSGVKWFDIKEKENEHREYRIYFIKENTIYSFDTKSKQTRSAQVDARLFSVMVTSKPLFIADIGIGVGIPRMKKILKM BD7B76AF04C0838D plxnc1-sem7a-1 3 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association To analyze the solution binding of PlexinC1 to its A39R and Sema7A ligands, we used isothermal titration calorimetry (ITC) Fig. 1D Temp=30C plxnc1-emv139-1 3 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Fig. 1E Temp=30C emv139-1 1 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Supp. Fig. 1 plxnc1-emv139-2 2 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 28 31 direct interaction direct interaction Supp. Table 1 2.3A R-working:23.9% R-free:27.6% MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. Virol. J. 2007 rapid curation Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins suggested by panni chris.butlercole@gmail.com rapid curation unknown Unknown ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins suggested by panni chris.butlercole@gmail.com Virol. J. 2007 rapid curation rapid curation An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. An ectromelia virus profilin homolog interacts with cellular tropomyosin and viral A-type inclusion protein. Virol. J. 2007 rapid curation Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins suggested by panni chris.butlercole@gmail.com rapid curation unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Butler-Cole C., Wagner MJ., Da Silva M., Brown GD., Burke RD., Upton C. Virus - Publications including interactions involving viral proteins suggested by panni chris.butlercole@gmail.com Virol. J. 2007 rapid curation rapid curation b1mty0_plemo TPM3 protein protein calmo Callicebus moloch MEFQEIQLKEAKHTAKEADRKYEEVVRELVITEGDLGCTEELAELAVSRCQKKDEQIRLTDQNLKCLSAAEEKYFPKEEKYEEEIKILTDKLKEAETCAEFSERQVATLEKTTDDLEDKLKCTKEENLCTQRMLDQTLLDLNEIQNTPVLPCCCSLCP mint A7BE0EFFC83F6A70 prof_ectvm Profilin EVM141 protein protein ectvm Ectromelia virus (strain Moscow) MAAEWHKIIEDVSKNNKFEDAAIVDYKTKKNVLAAIPNRTFAKIIPGEVIALITNRNILKPRIGQKFFIVYTNSLMDENTYTMELLTGYAPVSPIVIARTHTALIFLMGKPTTSRREVYRTCRDYATNVRATGN More likely to influence phosphoinositide metabolism than actin assembly mint 0335281EBE45AA6D ati_vaccw A-type inclusion protein A25 A25 VACWR148 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MEVTNLIEKCTKHSKDFATEVKKLWNDELSSESGLSRKTRNVIRNILRDITKSLTTDKKSKCFRILERSTINGEQIKDVYKTIFNNGVDVESRINTTGKYVLFTVMTYVAAELRLIKSDEIFALLSRFFNMICDIHRKYGCGNMFVGIPAALIILLEIDHINKLFSVFSTRYDAKAYLYTEYFLFLNINHYLLSGSDLFINVAYGAVSFSSPISVPDYIMEALTFKACDHIMKSGDLKYTYAFTKKVKDLFNTKSDSIYQYVRLHEMSYDGVSEDTDDDDEVFAILNLSIDSSVDRYRNRVLLLTPEVASLRKEYSDVEPDYKYLMDEEVPAYDKHLPKPITNTGIEEPHATGGDEDQPIKVVHPPNNDKDDAIKPYNPLEDPNYVPTITRTAIGIADYQLVINKLIEWLDKCEEECGNSGEFKTELEEAKRKLTELNAELSDKLSKIRTLERDSVYKTERIDRLTKEIKEHRDIQNGTDDGSDLLEIDKKTIRELRESLDREREMRSELEKELDTIRNGKVDGSCQRELELSRMWLKQRDDDLRAEIDKRRNVEWELSRLRRDIKECDKYKEDLDKAKTTISNYVSKISTLESEIAKYQQDRDTLSVVRRELEEERRRVRDLESRLDECTRNQEDTQEVDALRSRIRELENKLTDCIESGGGNLTEISRLQSKISDLERQLSECRENATEISRLQSRISDLERQLNDCRRNNETNAETERDATS mint Mature viruses are occluded into the ATI, and it has been assumed that such bodies protect the virus during dissemination from animal to animal 6763AADA13E7AAAA prof-ati 2 5 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait 4 unspecified role unspecified role neutral component neutral component colocalization colocalization F5 F9 homomint mint prof-tpm3 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association F5 mint