DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of a DnaB-family replicative helicase and its interactions with primase. The structure of a DnaB-family replicative helicase and its interactions with primase. Nature structural & molecular biology 2008 imex curation Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. DIP original experiment: DIP-113697X Nature structural & molecular biology 2008 IMEx The structure of a DnaB-family replicative helicase and its interactions with primase. The structure of a DnaB-family replicative helicase and its interactions with primase. The structure of a DnaB-family replicative helicase and its interactions with primase. Nature structural & molecular biology 2008 imex curation Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. DIP original experiment: DIP-113699X Nature structural & molecular biology 2008 IMEx The structure of a DnaB-family replicative helicase and its interactions with primase. The structure of a DnaB-family replicative helicase and its interactions with primase. The structure of a DnaB-family replicative helicase and its interactions with primase. Nature structural & molecular biology 2008 imex curation Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang G., Klein MG., Tokonzaba E., Zhang Y., Holden LG., Chen XS. DIP original experiment: DIP-113698X Nature structural & molecular biology 2008 IMEx The structure of a DnaB-family replicative helicase and its interactions with primase. Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating. Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating. Proceedings of the National Academy of Sciences of the United States of America 2009 imex curation Lhuillier S., Gallopin M., Gilquin B., Brasilès S., Lancelot N., Letellier G., Gilles M., Dethan G., Orlova EV., Couprie J., Tavares P., Zinn-Justin S. Only protein-protein interactions baciu Bacillus subtilis crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lhuillier S., Gallopin M., Gilquin B., Brasilès S., Lancelot N., Letellier G., Gilles M., Dethan G., Orlova EV., Couprie J., Tavares P., Zinn-Justin S. DIP original experiment: DIP-134226X Proceedings of the National Academy of Sciences of the United States of America 2009 IMEx Structure of bacteriophage SPP1 head-to-tail connection reveals mechanism for viral DNA gating. dnag_bacsu DNA primase dnaE BSU25210 dnaG protein protein bacsu Bacillus subtilis MGNRIPDEIVDQVQKSADIVEVIGDYVQLKKQGRNYFGLCPFHGESTPSFSVSPDKQIFHCFGCGAGGNVFSFLRQMEGYSFAESVSHLADKYQIDFPDDITVHSGARPESSGEQKMAEAHELLKKFYHHLLINTKEGQEALDYLLSRGFTKELINEFQIGYALDSWDFITKFLVKRGFSEAQMEKAGLLIRREDGSGYFDRFRNRVMFPIHDHHGAVVAFSGRALGSQQPKYMNSPETPLFHKSKLLYNFYKARLHIRKQERAVLFEGFADVISAVSSDVKESIATMGTSLTDDHVKILRRNVEEIILCYDSDKAGYEATLKASELLQKKGCKVRVAMIPDGLDPDDYIKKFGGEKFKNDIIDASVTVMAFKMQYFRKGKNLSDEGDRLAYIKDVLKEISTLSGSLEQEVYVKQLASEFSLSQESLTEQLSVFSKQNKPADNSGETKTRRAHLTTKARQKRLRPAYENAERLLLAHMLRDRSVIKKVIDRVGFQFNIDEHRALAAYLYAFYEEGAELTPQHLMARVTDDHISQLLSDILMLQVNQELSEAELSDYVKKVLNQRNWSMIKEKEAERAEAERQKDFLRAASLAQEIVTLNRSLK 525D8631845C14AA 525D8631845C14AA hcp16_bpspp Head completion protein gp16 16 Connector protein gp16 Gene product 16 Stopper protein gp16 protein protein bpspp Bacillus phage SPP1 Bacteriophage SPP1 MYEEFPDVITFQSYVEQSNGEGGKTYKWVDEFTAAAHVQPISQEEYYKAQQLQTPIGYNIYTPYDDRIDKKMRVIYRGKIVTFIGDPVDLSGLQEITRIKGKEDGAYVG DIP protein O48446 original sequence version: 34 q38152_bpspp DNA helicase protein protein bpspp Bacillus phage SPP1 Bacteriophage SPP1 MNPEEKTVMLYNEYAEQAVLGSILTEPELIKECPLTPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAARVGEKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNESDDGPVKPIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIESADGNITGVPSGFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDKESESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNLERRFDDR DIP protein Q38152 original sequence version: 43 q38152_bpspp-1 1 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction q38152_bpspp-2 3 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction dnag-q38152_bpspp-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 7 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction 16-2 4 6 unspecified role unspecified role unspecified role unspecified role O48446:p.Glu45Cys E45C mutation mutation certain certain sequence position certain certain certain sequence position certain E C This feature has been corrected as a result of our quality control procedures. The original label was 'E45C'. Wed May 02 15:55:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu45cys' Tue Jun 30 19:27:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu45Cys' O48446:p.Tyr47Cys Y47C mutation mutation certain certain sequence position certain certain certain sequence position certain Y C This feature has been corrected as a result of our quality control procedures. The original label was 'Y47C'. Wed May 02 19:39:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr47cys' Tue Jun 30 16:26:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr47Cys' O48446:p.Gln51Cys Q51C mutation mutation certain certain sequence position certain certain certain sequence position certain Q C This feature has been corrected as a result of our quality control procedures. The original label was 'Q51C'. Wed May 02 14:45:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln51cys' Tue Jun 30 17:24:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln51Cys' O48446:p.[Gln43Cys;Gln51Cys] Q43C/Q51C mutation mutation certain certain sequence position certain certain certain sequence position certain Q C certain certain sequence position certain certain certain sequence position certain Q C This feature has been corrected as a result of our quality control procedures. The original label was 'Q43C/Q51C'. Wed May 02 17:10:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln43cys,gln51cys' Tue Jun 30 15:55:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln43Cys;Gln51Cys]' baciu Bacillus subtilis direct interaction direct interaction