IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions aedae-hemocyte Aedes aegypti (Yellowfever mosquito) hemocyte Culex aegypti hemocyte Hemocyte fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. confocal microscopy confocal microscopy immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. A stable cell line was generated to express mosPTP-1 in S2 cells. Purified mosGCTL-1 was inoculated with mosPTP-1-expressing cells. An empty DNA vector transfected stable S2 cell line was used as the control.mosPTP-1 was stained by Alexa-488; mosGCTL-1 was stained by Phycoerythrin. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions aedae-salivary_gland Aedes aegypti (Yellowfever mosquito) salivary gland Culex aegypti salivary_gland Salivary gland fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. A C-Type Lectin Collaborates with a CD45 Phosphatase Homolog to Facilitate West Nile Virus Infection of Mosquitoes. Cell (0092-8674) 2010 imex curation Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu 06-April-2011: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cheng G., Cox J., Wang P., Krishnan MN., Dai J., Qian F., Anderson JF., Fikrig E. erol.fikrig@yale.edu Accepted 2010-Not a month!-8 by JYOTI. 06-April-2011: Contacted by JYOTI. Cell (0092-8674) 2010 jyoti Only protein-protein interactions imex curation p06935-pro_0000037746 Envelope protein E protein protein wnv West Nile virus (WNV) FNCLGMSNRDFLEGVSGATWVDLVLEGDSCVTIMSKDKPTIDVKMMNMEAANLADVRSYCYLASVSDLSTRAACPTMGEAHNEKRADPAFVCKQGVVDRGWGNGCGLFGKGSIDTCAKFACTTKATGWIIQKENIKYEVAIFVHGPTTVESHGKIGATQAGRFSITPSAPSYTLKLGEYGEVTVDCEPRSGIDTSAYYVMSVGEKSFLVHREWFMDLNLPWSSAGSTTWRNRETLMEFEEPHATKQSVVALGSQEGALHQALAGAIPVEFSSNTVKLTSGHLKCRVKMEKLQLKGTTYGVCSKAFKFARTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANSKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSIGKAFTTTLRGAQRLAALGDTAWDFGSVGGVFTSVGKAIHQVFGGAFRSLFGGMSWITQGLLGALLLWMGINARDRSIAMTFLAVGGVLLFLSVNVHA 291 787 540F552B8D60BC0B q17nz6_aedae CTLMA15 5563672 AAEL000563 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MLTKGITLILLLVLVHSSHGDSTPNRKFYIPSIRANWFKANEFCNSLKMRLVAIRSQEDNDAVARYVRTTSKFTDNCSFWIGASDLADEGTFVWVATGEEVTYTNWRENEPNNEGGNEDCIQLAYIPALNYHWSWNDNTCAGQSLYFICESVECDCVQPF 8EEF39A570B4502F q16k62_aedae Protein-tyrosine-phosphatase AAEL013105 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MKTRLLTTLTWLALVQVLVVLVNHRGCALATVNLTESNGSTPYVVSEPEIPYEELEEPRVLPLQALPVSVKASSSESPNGADADIRNKHRFNQNIHGPDQPHADINTVLKVILEEPEINDEPFTTTHGYPTFSAYDNIVPSKPLNLSVLEVTSTTIKITWREPEKLNGAIHGYRVYYVHQNQTLLHLPILKADAAVNSVYTYTLSNLKPYTDYKIIVAAFTKKFDGEPSEVSQRTDISGPSAPKVVNLTCHSQHELLFGWHIPQTYYNTIDYYIISYRNLEHSEYKDIRLSANSSIVETSMIIPNLTTNMVYEVKVRAASASVINPKQIILGSYSEPKKISLQLHCEKIPQPSQRQVYDDYNLAVLGGIVFSCFGLLLIVLSFLLWKKCFHAAYYYLDDPPACQGANTAGLIDWEAPCEVAGEVRGPIPVTEFAKHVASLHVDGDIGFSKEYEAIQGEALNDEYPSEHSQHPDNKGKNRYLNVIAYDHSRVHLRQVPGQKKHLDYINANYIDGYQRPRSFIGTQGPLPGTFDCFWRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGAEMYGVIQVRLIREDVMATYTVRTLQIKHTKLKKKKASQSEKLVYQYHYTNWPDHGTPDHPLPVINFVKKSTAANPSDAGPIVVHCSAGVGRTGTYIVLDAMLKQIESKGMLNVFGFLRYIRAQRNYLVQTEEQYIFIHDALVEAIDSGETNIKMDAIGGLVNNIDFIDNQYKLITSYQPKEINLTSALKSVNAIKNRSSLVPLEGSRVHLTPKPGVEGSDYINASWLHGFRRLRDFVVTQHPLIETFKDFWQMVWDHNAQTVVLLSSADNMSFLQFWPNESEPMESDYYRIRMVSETSENNYIVRNFVIQSIQDDYELSVRMFENPMWPDMANPRSIYDFAVRVHERCAQYRNGPIVVVDRYHWKYF 8DF726D50A069E4F gctl1-e_wnv-1 5 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Interaction is calcium-dependent. mosGCTL-1 interacted with WNV E protein in a coimmunoprecipitation assay. Fig. 3B gctl1-e_wnv-2 1 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Colocalization of mosGCTL-1 and WNV was clearly observed in both tissues at various intervals after WNV infection Fig. 3E gctl1-ptp1-1 7 10 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction mosGCTL-1 interacts with mosPTP-1-Ex peptide by coimmunoprecipitation. Fig. 3D gctl1-ptp1-2 4 10 unspecified role unspecified role prey prey extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 9 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association mosPTP-1 captured mosGCTL-1 to the cell surface by flow cytometry. Fig. 3E gctl1-ptp1-3 3 10 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. colocalization colocalization Confocal microscopy to examine for mosPTP-1 and mosGCTL-1. Fig. 4F gctl1-e_wnv-3 6 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Colocalization of mosGCTL-1 and WNV was clearly observed in both tissues at various intervals after WNV infection Supp. Fig. 3E gctl1-e_wnv-4 6 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Several regions in the salivary glands with substantial mosPTP-1 also demonstrated staining for mosGCTL-1 and WNV (Figure 5D). Fig. 5D gctl1-e_wnv-5 2 9 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 8 unspecified role unspecified role prey prey direct interaction direct interaction mosGCTL-1 antisera blocked the interaction between mosGCTL-1 and WNV E protein. Fig. 6A MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. FEBS J. (1742-464X) 2010 imex curation Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. FEBS J. (1742-464X) 2010 imex curation Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. Only protein-protein interactions in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. FEBS J. (1742-464X) 2010 imex curation Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. Aegyptin displays high-affinity for the von Willebrand factor binding site (RGQOGVMGF) in collagen and inhibits carotid thrombus formation in vivo. FEBS J. (1742-464X) 2010 imex curation Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Calvo E., Tokumasu F., Mizurini DM., McPhie P., Narum DL., Ribeiro JM., Monteiro RQ., Francischetti IM. FEBS J. (1742-464X) 2010 Only protein-protein interactions imex curation co3a1_human Collagen alpha-1(III) chain COL3A1 protein protein human Homo sapiens Human MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL B904B4E05E17D339 co1a1_human Collagen alpha-1(I) chain Alpha-1 type I collagen COL1A1 protein protein human Homo sapiens Human MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGLPGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGAEGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPTGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDVGAPDQEFGFDVGPVCFL DIP protein P02452 original sequence version: 145 F0EC4DE778FFFC11 all3_aedae 30 kDa salivary gland allergen Aed a 3 AAEL010235 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MKPLVKLFLLFCLVGIVLSRPMPEDEEPVAEGGDDDASGESEGEEETTDDAGGDGGEEENEGEEHAGDKDAGGEDTGKEENTGHDDAGEEDAGEEDAGEEDAGEEDAGEEDAEKEEGEKEDAGDDAGSDDGEEDSTGGDEGEDNAEDSKGSEKNDPADTYRQVVALLDKDTKVDHIQSEYLRSALNNDLQSEVRVPVVEAIGRIGDYSKIQGCFKSMGKDVKKVISEEEKKFKSCMSKKKSEYQCSEDSFAAAKSKLSPITSKIKSCVSSKGR mint C827EFA0FE76E721 col1a1-all3 4 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F2B mint col1a1-all3-1 4 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F2A mint col1a1-all3-2 4 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal Collagen 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F5c mint col1a1-all3-3 2 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F2D mint col1a1-all3-4 3 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F2C mint col3a1-all3 1 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F3E mint col3a1-all3-1 1 Aegyptin 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Collagen 5 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint F3E F3C F3D DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An insulin-like peptide regulates egg maturation and metabolism in the mosquito Aedes aegypti. An insulin-like peptide regulates egg maturation and metabolism in the mosquito Aedes aegypti. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Brown MR., Clark KD., Gulia M., Zhao Z., Garczynski SF., Crim JW., Suderman RJ., Strand MR. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Brown MR., Clark KD., Gulia M., Zhao Z., Garczynski SF., Crim JW., Suderman RJ., Strand MR. DIP original experiment: DIP-68650X Proceedings of the National Academy of Sciences of the United States of America 2008 IMEx An insulin-like peptide regulates egg maturation and metabolism in the mosquito Aedes aegypti. insr_aedae Insulin-like receptor InR AAEL002317 protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MVSLLLFSILVVPVAVVQGDEMKAGQVGPVPKGGVCGSVDVRNSPAHLDRLKDCVVVEGFVHILLIDKYIDSSFENYSFPLLTEITEYLLLFRVNGLKSLRRLFPNLAVIRGDALVGDYAMVIYELMHIEEIGLISLMDITRGGVRIEKNPKLCFANTIDWKAMTVPGTNNYIKDNQKDNVCPICPAESTAVMLPNGSKQKCPAAPVRGGNKDHKRTLCWNANHCQTICPPECPKACSKTGVCCDAESCLGGCNLPNTSSCSVCRHLSIDPAGKRQCVAKCPPNTFKYHTRCVTRDECYAMKKPISLDSNPDLPDQPFIPHNGSCLMECPLDHELITELNKTRWCRKCSGTCPKRCEGSNIDNIQSAQLLKGCEIIDGSLEIQLRSRGGENIVKELENFLSSITEIKGYLKVVRSYPLLSLGFLKKLKIIHGKGNKVSNSSLYVVENQNLQELFDHNVTIGEGKLFFFNNPMLCTDRIKAVKKYNPGIEIENESQLESNNGDRAACSITELETSLKSIGSETAIIQWAPFTELSDARMLLGYVIYYIEAPYANVTFFDGRDACNTEGWRLDDISDFNMDKETTKILTQLKPYTQYAYYVKTYTLGSEGLGGQSKIKYFTTAPGTPSVVRDVEVSVNKNMLTVKWLPPLKMNGRLKEYEVFIELNADDNEQLMLRDYCEDDKLRDIVPETPTSAPPPKTSICTADQCRNYCKAPTSGGSTGTIDVTDKENQITFEDQLHNYVYIKNPLLRDKTTRRKRSTNLLFPNNTENKKNDTTDRRTEKVKDEPYYQYIFNATNETSITFPLSYFNHYSLYVFKIRACRHPGDPPAPSVRLVDVELACGNEVFENFRTPKKEGADDIPPESILIEEQSNNTQRQIRVQWKEPSKPNGPIVKFVVKYQRVDLESVSSTDICIRYSSFNQTRGALLTKLEPGNYSIRVMATTIAGDGAPSAARYVLIAKDDSMGTTLIWLGTLIVIFLCSVGFVAFYWYKYRYMSKQIRMYPEVNPDYAGVQYKVDDWEVERNHIIQLEELGQGSFGMVYKGILTQLRGEKCNQPCAIKTVNESATAREKDSFLLEASVMKQFNTHHVVRLLGVVSQGDPTLVIMELMANGDLKSYLRRHRPDYENGEDPSPQPPTLRQIIQMAIEIADGMAYLSAKKFVHRDLAARNCMVADDMTVKIGDFGMTRDIYETDYYRKGTKGFLPVRWMAPESLKDGIFSSSSDVFSYGVVLWEMATLASQPYQGLTNDQVLRYVIDGGVMERPENCPDNLYNLMRRCWQHRPTARPTFMEIISELLPDASPHFQDVAFYNSQDALDMLRGQHQTVIIDEATTPLRPGDDHDEEPGEDDDLVGHGEGHIGDVGTDDEFSMEMTNSHLVRNNGPMATIRSPHSPLR DIP protein Q93105 original sequence version: 71 a0ezr6_aedae protein protein aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito MSSTNLRVSSHLGLGSTMMHWGLMVLMVGTVVQAADQRFCGKQLVLTLSMLCDEFPDLHYGAKKSLNDYDKDYSTDEWLAMIGQDPESIVSTDLMVPHMDQQTVQQQQKVPLWMAMMYPQGYGFRSSASRNDLIPPRFRKSPRGIVDECCLRPCSINQLLKYCKTIA DIP protein A0EZR6 original sequence version: 7 a0ezr6_aedae-inr-1 1 3 unspecified role unspecified role unspecified role unspecified role in vitro In vitro 2 unspecified role unspecified role unspecified role unspecified role aedae Aedes aegypti (Yellowfever mosquito) Culex aegypti Yellowfever mosquito physical association physical association