DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the thrombin complex with triabin, a lipocalin-like exosite-binding inhibitor derived from a triatomine bug. Structure of the thrombin complex with triabin, a lipocalin-like exosite-binding inhibitor derived from a triatomine bug. Proceedings of the National Academy of Sciences of the United States of America 1997 imex curation Fuentes-Prior P., Noeske-Jungblut C., Donner P., Schleuning WD., Huber R., Bode W. Wolfram Bode 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Fuentes-Prior P., Noeske-Jungblut C., Donner P., Schleuning WD., Huber R., Bode W. Wolfram Bode Accepted 2020-OCT-01 AT 13:44 BST AT 13:44 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 1997 Only protein-protein interactions imex curation imex curation pro_0000028157 Thrombin light chain F2 protein protein bovin Bos taurus (Bovine) Bovine TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR 18574CB967E80157 q27049-pro_0000017994 Triabin protein protein Triatomine bug Meccus pallidipennis Triatoma pallidipennis AEGDDCSIEKAMGDFKPEEFFNGTWYLAHGPGVTSPAVCQKFTTSGSKGFTQIVEIGYNKFESNVKFQCNQVDNKNGEQYSFKCKSSDNTEFEADFTFISVSYDNFALVCRSITFTSQPKEDDYLVLERTKSDTDPDAKEIC 19 160 96713FAC68593323 pro_0000028158 Thrombin heavy chain F2 protein protein bovin Bos taurus (Bovine) Bovine IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS 4C2387588CA7C71B f2-f2-3 1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 9inse 9inse physical association physical association Fig 1, Table 1