IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Importance of glycosylation in the interaction of Tamm-Horsfall protein with collectin-11 and acute kidney injury. Journal of cellular and molecular medicine 2020 imex curation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. cyq@bjmu.edu.cn 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro array technology array technology tag visualisation tag visualisation Gong K., Xia M., Wang Y., Bai L., Ying W., Zhu F., Chen Y. For results from Supp. Fig 2C:- WFA and "lentil" lectin only give weak signals, and DBA + AAA cannot be identified.-so no interactions entered. Lectins found in "Manual" from suppliers web site. Only lectins that are identifiable and produce a strong positive signal have been entered here as interactors. cyq@bjmu.edu.cn Accepted 2021-FEB-02 AT 09:25 GMT AT 09:25 GMT by PPORRAS Journal of cellular and molecular medicine 2020 Only protein-protein interactions imex curation imex curation urom_human Uromodulin UMOD Tamm-Horsfall urinary glycoprotein protein protein human Homo sapiens Human MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRFVGQGGARMAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSRKACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCKQDFNITDISLLEHRLECGANDMKVSLGKCQLKSLGFDKVFMYLSDSRCSGFNDRDNRDWVSVVTPARDGPCGTVLTRNETHATYSNTLYLADEIIIRDLNIKINFACSYPLDMKVSLKTALQPMVSALNIRVGGTGMFTVRMALFQTPSYTQPYQGSSVTLSTEAFLYVGTMLDGGDLSRFALLMTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQMFRFAGNYDLVYLHCEVYLCDTMNEKCKPTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPLLLSATLTLTFQ D26A07A76353AE48 a0a2d0tci3_agrcy Galectin protein protein Toadstool Agrocybe cylindracea Pholiota aegerita MDYKDDDDKHMTTSAVNIYNISAGASVDLAAPVTTGDIVTFFSSALNLSAGAGSPNNTALNLLSENGAYLLHIAFRLQENVIVFNSRQPNAPWLVEQRVSNVANQFIGSGGKAMVTVFDHGDKYQVVINEKTVIQYTKQISGTTSSLSYNSTEGTSIFSTVVEAVTYTGLAKLAAALE 0DB71AC6C541460B a0a2d0tci3_agrcy-umod-1 1 2 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-urine human urine urine urine 3 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 2, number 1 Carbohydrate specificity:alpha-2-3 Sialic Acid