IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The intraviral protein-protein interaction of SARS-CoV-2 reveals the key role of N protein in virus-like particle assembly. The intraviral protein-protein interaction of SARS-CoV-2 reveals the key role of N protein in virus-like particle assembly. International journal of biological sciences 2020 imex curation Chen M., Yan C., Qin F., Zheng L., Zhang XE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus zhangxe@ibp.ac.cn,mh.chen1@siat.ac.cn. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. complementation protein complementation assay PCA complementation tag fluorescence tag visualisation by fluorescence tag fluorescence Chen M., Yan C., Qin F., Zheng L., Zhang XE. Virus - Publications including interactions involving viral proteins Assay using iRFP-based trimolecular fluorescence complementation (TriFC) system, pmid:34266873. An assay for RNA/protein interaction. iRFP is a near-infrared fluorescent protein split into N (iRN) and C (iRC) terminal fragments. iRN is linked to the protein of interest;iRC is linked to pECFP-ms2/MCP vector which is linked to the RNA of interest. Red TriFC fluorescence signals can be detected when the protein and RNA of interest interact. zhangxe@ibp.ac.cn,mh.chen1@siat.ac.cn. Accepted 2021-DEC-02 AT 16:34 GMT AT 16:34 GMT by LUANA International journal of biological sciences 2020 Only protein-protein interactions imex curation imex curation The intraviral protein-protein interaction of SARS-CoV-2 reveals the key role of N protein in virus-like particle assembly. The intraviral protein-protein interaction of SARS-CoV-2 reveals the key role of N protein in virus-like particle assembly. International journal of biological sciences 2020 imex curation Chen M., Yan C., Qin F., Zheng L., Zhang XE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus zhangxe@ibp.ac.cn,mh.chen1@siat.ac.cn. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chen M., Yan C., Qin F., Zheng L., Zhang XE. Virus - Publications including interactions involving viral proteins Supp. fig 4: Venus tags are reversed - so had to enter as new interactions mostly. zhangxe@ibp.ac.cn,mh.chen1@siat.ac.cn. Accepted 2021-DEC-02 AT 16:34 GMT AT 16:34 GMT by LUANA International journal of biological sciences 2020 Only protein-protein interactions imex curation imex curation a0a7d6cat9_sars2 ORF10 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MGYINVFAFPFTIYSLLLCIMNSRNYIAQVDVVNFNLT AE48BF9F1598073C ns7b_sars2 ORF7b protein Accessory protein 7b 7b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA ap3a_sars2 ORF3a protein Accessory protein 3a Protein U274 Protein X1 3a Protein 3a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL genomic_rna rna ribonucleic acid RNA rna SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV ns8_sars2 ORF8 protein Non-structural protein 8 8 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI 912AD9E147A64907 vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV vme1_sars2 Membrane protein E1 glycoprotein Matrix glycoprotein Membrane glycoprotein M protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA ns7a_sars2 ORF7a protein Accessory protein 7a Protein U122 Protein X4 7a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT ns6_sars2 ORF6 protein Accessory protein 6 Protein X3 6 Non-structural protein 6 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID n-n-61 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1, Supp. figure 4A vme1_sars2-vme1_sars2-1 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 s-s-15 2 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns7a_sars2-ns7a_sars2-1 2 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns7b_sars2-ns7b_sars2-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ap3a_sars2-ns7b_sars2-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns6_sars2-vme1_sars2-1 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-ns6_sars2-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 e-ns6_sars2-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns6_sars2-ns7b_sars2-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns7a_sars2-vme1_sars2-1 2 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns7a_sars2-ns7b_sars2-1 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 e-ns7b_sars2-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-ns7b_sars2-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 e-ns8_sars2-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-ns8_sars2-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 e-orf10-1 2 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 ns7a_sars2-ns7b_sars2-2 2 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-orf10-1 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 e-n-3 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-vme1_sars2-6 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 n-s-2 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Table 1, Figure 1 genomic_rna-n-34 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed PS756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain iRC fragment tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed iRN fragment tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B stated sequence coordinates 19786-20361 are correct. Weak binding was observed when using the N-terminal region (residues 1-246) of the N protein. e-n-4 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. figure 4B n-vme1_sars2-7 2 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. figure 4B n-s-3 2 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-c venus c-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region venus-n venus n-terminal fragment undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp figure 4B