IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. Proteins 2021 imex curation El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Only protein-protein interactions imex curation in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Accepted 2021-AUG-23 AT 05:27 BST AT 05:27 BST by KALPANAP Proteins 2021 Only protein-protein interactions imex curation imex curation A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. Proteins 2021 imex curation El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Accepted 2021-AUG-23 AT 05:27 BST AT 05:27 BST by KALPANAP Proteins 2021 Only protein-protein interactions imex curation imex curation A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. A distinct ssDNA/RNA binding interface in the Nsp9 protein from SARS-CoV-2. Proteins 2021 imex curation El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Only protein-protein interactions imex curation in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli predetermined predetermined participant predetermined El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R., El-Kamand S., Du Plessis MD., Breen N., Johnson L., Beard S., Kwan AH., Richard DJ., Cubeddu L., Gamsjaeger R. Virus - Publications including interactions involving viral proteins r.gamsjaeger@westernsydney.edu.au,l.cubeddu@westernsydney.edu.au Accepted 2021-AUG-23 AT 05:27 BST AT 05:27 BST by KALPANAP Proteins 2021 Only protein-protein interactions imex curation imex curation ssrna_oligo (uracilx23) rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) UUUUUUUUUUUUUUUUUUUUUUU ssdna_oligo (thymidine x23) ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) TTTTTTTTTTTTTTTTTTTTTTT p0dtd1-pro_0000449627 Non-structural protein 9 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ 4141 4253 rep-266 2 6 unspecified role unspecified role neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 2 the HIS-tag is specifically stated NOT to have been removed for SEC. rep-267 1 5 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4, Supp. figure 1 rep-ssdna_oligo (thymidine x23)-1 1 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 4, Supp. figure 1 ssrna_oligo (uracilx23)-rep-1 3 4 unspecified role unspecified role bait bait 5' prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey purified purified P0DTD1-PRO_0000449627:p.Tyr66Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A P0DTD1-PRO_0000449627:p.Phe40Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A P0DTD1-PRO_0000449627:p.Lys92Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A P0DTD1-PRO_0000449627:p.[Arg55Ala;Lys92Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A P0DTD1-PRO_0000449627:p.Arg55Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A ecoli Escherichia coli (strain K12) direct interaction direct interaction 7, Supp. figure 2 Kd >450 uM and >1000 uM for K92A and R55/K92A, respectively.