IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins another 'strange/dodgy' assay; certainly NOT "Far Western". The tag on Spike must be "SBP" (Strep binding peptide) as mentioned at top of Methods - NOT "Strep", as the Pull down used Avidin. pVRC vector is Bacterial. cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay anti tag western anti tag western blot anti tag western Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Results from figure 5B have not been added as no purification of CD209L was carried out before placing on membrane. I am not sure if this is a Far Western or not - probably NOT a Dot-Blot (Filter Binding assay). Thus Experiment has been entered at the next level up. cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. CD209L/L-SIGN and CD209/DC-SIGN Act as Receptors for SARS-CoV-2. ACS central science 2021 imex curation Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cecmsms@bu.edu,nrahimi@bu.edu Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Amraei R., Yin W., Napoleon MA., Suder EL., Berrigan J., Zhao Q., Olejnik J., Chandler KB., Xia C., Feldman J., Hauser BM., Caradonna TM., Schmidt AG., Gummuluru S., Mühlberger E., Chitalia V., Costello CE., Rahimi N. Virus - Publications including interactions involving viral proteins I have added as "In vitro" as there is no method for IP, and only "cell lysate" mentioned for CD209L In the Supplement it states for one IP that they mixed 1:1 - so I have assumed they did the same elsewhere. (???) cecmsms@bu.edu,nrahimi@bu.edu Accepted 2021-NOV-22 AT 17:32 GMT AT 17:32 GMT by SIMONA ACS central science 2021 Only protein-protein interactions imex curation imex curation ace2_human Angiotensin-converting enzyme 2 ACE2 UNQ868/PRO1885 Angiotensin-converting enzyme homolog Metalloprotease MPROT15 Angiotensin-converting enzyme-related carboxypeptidase protein protein human Homo sapiens Human MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF mint Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses 8EE6EB0A931550E8 clc4m_human C-type lectin domain family 4 member M CD209 antigen-like protein 1 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 DC-SIGN-related protein Liver/lymph node-specific ICAM-3-grabbing non-integrin CLEC4M CD209L CD209L1 CD299 protein protein human Homo sapiens Human MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE 0FADC99F72AEA593 cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT s-clec4m-5 4 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4D s-clec4m-6 5 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 E/F s-cd209-6 5 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 E/F s-ace2-92 5 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 4 E/F s-clec4m-8 6 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 10 unspecified role unspecified role bait bait rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 9C clec4m-ace2-1 6 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Supp. figure 10 clec4m-ace2-2 3 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Supp. figure 11 s-clec4m-10 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4B s-clec4m-11 2 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. figure 9B s-clec4m-4 1 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] 10 unspecified role unspecified role bait bait rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus sbp sbp c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 9C clec4m-ace2-3 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Supp. figure 10