IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles. Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles. Frontiers in immunology 2020 imex curation Hsieh MH., Beirag N., Murugaiah V., Chou YC., Kuo WS., Kao HF., Madan T., Kishore U., Wang JY. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus rfhSP-D: found details of construct from ref 25 and refs from that. Ref 26 and several from ref. 25 were wild goose chases. Details for rfhSP-D were found from PMID: 29915574. a122@mail.ncku.edu.tw,uday.kishore@brunel.ac.uk,ukishore@hotmail.com Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Hsieh MH., Beirag N., Murugaiah V., Chou YC., Kuo WS., Kao HF., Madan T., Kishore U., Wang JY. Virus - Publications including interactions involving viral proteins It is unclear as to whether Full length SP-D was produced in the Human 293 cell line or Mouse NSO myeloma cell line, as the text states:- "recombinant human full-length SP-D (hFL-SP-D, R&D, 1920-SP produced in HEK 293 cells". However the catalogue number quoted -R&D, 1920-SP- states NSO cells. rfhSP-D: found details of construct from ref 25 and refs from that. Ref 26 and several from ref. 25 were wild goose chases. Details for rfhSP-D were found from PMID: 29915574. a122@mail.ncku.edu.tw,uday.kishore@brunel.ac.uk,ukishore@hotmail.com Accepted 2021-AUG-02 AT 12:47 BST AT 12:47 BST by KALPANAP Frontiers in immunology 2020 Only protein-protein interactions imex curation imex curation p35247-pro_0000017465 Pulmonary surfactant-associated protein D Collectin-7 Lung surfactant protein D COLEC7 PSPD SFTP4 SFTPD protein protein human Homo sapiens Human AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF 21 375 A368D20260624CDB ethylenediaminetetraacetic acid ethylenediaminetetraacetic acid (ethylenedinitrilo)tetraacetic acid, ion(4-) 2,2',2'',2'''-(ethane-1,2-diyldinitrilo)tetraacetate acide edetique Acide ethylenediaminetetracetique acido edetico acidum edeticum Edetic acid edetic acid EDTA edta EDTA, ion(4-) ethylenediaminetetraacetate ethylenediaminetetraacetic acid Ethylenediaminetetraacetic acid H4edta N,N'-1,2-Ethane diylbis-(N-(carboxymethyl)glycine) {[-(BIS-CARBOXYMETHYL-AMINO)-ETHYL]-CARBOXYMETHYL-AMINO}-ACETIC ACID (ethane-1,2-diyldinitrilo)tetraacetate (ethane-1,2-diyldinitrilo)tetraacetic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) maltose Maltose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT s-sftpd-3 1 5 unspecified role unspecified role bait bait purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified direct interaction direct interaction 1A RHS s-sftpd-5 1 4 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role bait bait purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35247-PRO_0000017465:p.Pro180Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Mon Jun 28 17:45:55 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A s-sftpd-7 1 5 unspecified role unspecified role bait bait purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35247-PRO_0000017465:p.Pro180Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Mon Jun 28 17:06:11 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1A LHS, 2A s-sftpd-9 1 3 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role bait bait purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35247-PRO_0000017465:p.Pro180Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Mon Jun 28 17:36:02 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2A s-sftpd-10 1 5 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified direct interaction direct interaction 1B RHS s-sftpd-11 1 5 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35247-PRO_0000017465:p.Pro180Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Mon Jun 28 16:54:19 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B LHS, 2B s-sftpd-12 1 4 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role bait bait purified purified rbd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain unknown tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35247-PRO_0000017465:p.Pro180Ser mutation mutation certain certain sequence position certain certain certain sequence position certain P S Mon Jun 28 17:33:48 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro180Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B Chelation of Ca2+ by EDTA did not significantly affect the interaction between rfhSP-D and RBD region.