IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. PLoS pathogens 2021 imex curation Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Accepted 2021-OCT-13 AT 16:48 BST AT 16:48 BST by SIMONA PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. PLoS pathogens 2021 imex curation Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tem transmission electron microscopy tem predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Accepted 2021-OCT-13 AT 16:48 BST AT 16:48 BST by SIMONA PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. PLoS pathogens 2021 imex curation Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. MGL identified as Clec10a or CD301 from PMID: 31248427 rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Accepted 2021-OCT-13 AT 16:48 BST AT 16:48 BST by SIMONA PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. DC/L-SIGN recognition of spike glycoprotein promotes SARS-CoV-2 trans-infection and can be inhibited by a glycomimetic antagonist. PLoS pathogens 2021 imex curation Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F., Thépaut M., Luczkowiak J., Vivès C., Labiod N., Bally I., Lasala F., Grimoire Y., Fenel D., Sattin S., Thielens N., Schoehn G., Bernardi A., Delgado R., Fieschi F. Virus - Publications including interactions involving viral proteins The M. wt of Spike monomer is 128kDa;thus no entry from figures 1A/B as they do not show a trimer or dimer. rafael.delgado@salud.madrid.org,franck.fieschi@ibs.fr Accepted 2021-OCT-13 AT 16:48 BST AT 16:48 BST by SIMONA PLoS pathogens 2021 Only protein-protein interactions imex curation imex curation pm26 PM26 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q8iun9-2 C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH 5472EFF9EBC7AC19 cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 clc4k_human C-type lectin domain family 4 member K CD207 CLEC4K Langerin protein protein human Homo sapiens Human MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQAVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP 83DF432682BF4B62 spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT clc4m_human C-type lectin domain family 4 member M CD209 antigen-like protein 1 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 DC-SIGN-related protein Liver/lymph node-specific ICAM-3-grabbing non-integrin CLEC4M CD209L CD209L1 CD299 protein protein human Homo sapiens Human MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE 0FADC99F72AEA593 s-82 1 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:07:01 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1c Sample quality and trimeric assembly were confirmed by 2D class averages of the Spike protein. I can just about believe this is a trimer from the image s-83 2 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 16:57:57 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:35:58 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1D-G s-cd209-3 3 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:39:18 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 2, Table 1 Non-oriented-11.90uM; Oriented-4.33uM s-clec4m-3 3 10 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:40:31 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 2, Table 1 Non-oriented-1.80uM; Oriented-1.66uM s-clec10a-2 3 6 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 16:51:51 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 2, Table 1 Non-oriented 7.0uM s-cd207-1 3 8 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus strep tag strep tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined OmpA signal peptide tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:47:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 2, Table 1 Langerin has an affinity of at least one order of magnitude lower than L/DC-SIGN. s-cd209-4 1 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:22:17 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 3C Most images show a 1:1 complex but, in some cases, (Fig 3C, left) at least two molecules of DC-SIGN interacting with the spike protein can be detected. cd209-s-11 1 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 16:47:42 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 3C Most images show a 1:1 complex but, in some cases, (Fig 3C, left) at least two molecules of DC-SIGN interacting with the spike protein can be detected. s-cd209-5 3 5 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 16:51:12 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 6 B/C, Supp. figure S2. cd209-s-12 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Arg682_Arg685delinsGlySerAlaSer;Lys986_Val987delinsProPro] mutation mutation certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain RRAR GSAS Mon Jun 28 17:44:05 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg682_Arg685delinsGlyGlySerGly;Lys986_987Val]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range T4 fibritin trimerization motif tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Supp. figure 1C The spike protein interacts with various numbers of DC-SIGN ECD.