UniProt UniProt http://www.uniprot.org Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Theranostics 2020 imex curation Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Accepted 2021-DEC-02 AT 11:34 GMT AT 11:34 GMT by LUANA Theranostics 2020 Only protein-protein interactions imex curation imex curation Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Theranostics 2020 imex curation Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Only protein-protein interactions imex curation human-smmc7721 Human SMMC7721 Hepatoma cell line smmc7721 SMMC7721 Hepatoma cell line This cell line originated in China prior to 1980. No PMID reference findable but:- Tong R et al., The establishment and primary biological characteristics of human hepatoma SMMC-7721 cell line.J 2nd Milit Med Univ, 1980;1(1):5-9. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Accepted 2021-DEC-02 AT 11:34 GMT AT 11:34 GMT by LUANA Theranostics 2020 Only protein-protein interactions imex curation imex curation Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Theranostics 2020 imex curation Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Only protein-protein interactions imex curation human-mhcc97h human-MHCC97H -highly metastatic subclone of MHCC97 Human mhcc97h MHCC97H -highly metastatic subclone of MHCC97 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Accepted 2021-DEC-02 AT 11:34 GMT AT 11:34 GMT by LUANA Theranostics 2020 Only protein-protein interactions imex curation imex curation Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Cellular senescence in hepatocellular carcinoma induced by a long non-coding RNA-encoded peptide PINT87aa by blocking FOXM1-mediated <i>PHB2</i>. Theranostics 2020 imex curation Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xiang X., Fu Y., Zhao K., Miao R., Zhang X., Ma X., Liu C., Zhang N., Qu K. Origin of FOXM1 not given, and the CHinese company not accessible via Google but I found several other papers which had bought FOXM1 from this company and in each case it was human. qukai001@xjtu.edu.cn Accepted 2021-DEC-02 AT 11:34 GMT AT 11:34 GMT by LUANA Theranostics 2020 Only protein-protein interactions imex curation imex curation a0a455zar2_human circPINTexon2 hCG_1645276 protein protein human Homo sapiens Human MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK 061E65717CFB8CB2 foxm1_human Forkhead box protein M1 Hepatocyte nuclear factor 3 forkhead homolog 11 Winged-helix factor from INS-1 cells M-phase phosphoprotein 2 MPM-2 reactive phosphoprotein 2 Transcription factor Trident Forkhead-related protein FKHL16 WIN FOXM1 FKHL16 HFH11 MPP2 protein protein human Homo sapiens Human MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKTPIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ DIP protein Q08050 original sequence version: 142 963CAC8FE7498E9B circpintexon2-foxm1-1 4 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5B, Supp. Fig. 4B foxm1-circpintexon2-1 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 5B, Supp. Fig. 4B circpintexon2-foxm1-2 2 6 unspecified role unspecified role neutral component neutral component cell lysate cell lysate fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5C circpintexon2-foxm1-3 3 6 unspecified role unspecified role neutral component neutral component cell lysate cell lysate fixed cell fixed cell 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5C