IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down sequence tag sequence tag identification sequence tag Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. "NHLFs" -Normal Human Lung Fibroblasts". Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. A549–hACE2 cells Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity. Nature microbiology 2021 imex curation Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU., Liu G., Lee JH., Parker ZM., Acharya D., Chiang JJ., van Gent M., Riedl W., Davis-Gardner ME., Wies E., Chiang C., Gack MU. Virus - Publications including interactions involving viral proteins Results removed from figure 5B and some of 5E. Also Ext. data 6A and Fig. 2c - all due to missing species info for FLAG-ISG15 - which is probably Murine, but carefully not mentioned in this publication. Interactions involving FLAG-ISG15 and HA-LGP2 have not been curated as the species origins of these constructs is not stated and the authors did not reply to a request for information. HA-14-3-3 eta species origin has been taken from Ref. 47 - pmid: 31600501. gackm@ccf.org Accepted 2021-APR-19 AT 09:17 BST AT 09:17 BST by KALPANAP Nature microbiology 2021 Only protein-protein interactions imex curation imex curation p0c6x5-pro_0000283876 Non-structural protein 3 rep ORF1ab polyprotein 1a-1b protein protein cvhnl Human coronavirus NL63 HCoV-NL63 GKISFSDDVIVHDVEPTHKVKLIFEFEDDVVTSLCKKSFGKSIIYTGDWEGLHEVLTSAMNVIGQHIKLPQFYIYDEEGGYDVSKPVMISQWPISNDSNGCVVEASTDFHQLECIVDDSVREEVDIIEQPFEEVEHVLSIKQPFSFSFRDELGVRVLDQSDNNCWISTTLVQLQLTKLLDDSIEMQLFKVGKVDSIVQKCYELSHLISGSLGDSGKLLSELLKEKYTCSITFEMSCDCGKKFDDQVGCLFWIMPYTKLFQKGECCICHKMQTYKLVSMKGTGVFVQDPAPIDIDAFPVKPICSSVYLGVKGSGHYQTNLYSFNKAIDGFGVFDIKNSSVNTVCFVDVDFHSVEIEAGEVKPFAVYKNVKFYLGDISHLVNCVSFDFVVNAANENLLHGGGVARAIDILTEGQLQSLSKDYISSNGPLKVGAGVMLECEKFNVFNVVGPRTGKHEHSLLVEAYNSILFENGIPLMPLLSCGIFGVRIENSLKALFSCDINKPLQVFVYSSNEEQAVLKFLDGLDLTPVIDDVDVVKPFRVEGNFSFFDCGVNALDGDIYLLFTNSILMLDKQGQLLDTKLNGILQQAALDYLATVKTVPAGNLVKLFVESCTIYMCVVPSINDLSFDKNLGRCVRKLNRLKTCVIANVPAIDVLKKLLSSLTLTVKFVVESNVMDVNDCFKNDNVVLKITEDGINVKDVVVESSKSLGKQLGVVSDGVDSFEGVLPINTDTVLSVAPEVDWVAFYGFEKAALFASLDVKPYGYPNDFVGGFRVLGTTDNNCWVNATCIILQYLKPTFKSKGLNVLWNKFVTGDVGPFVSFIYFITMSSKGQKGDAEEALSKLSEYLISDSIVTLEQYSTCDICKSTVVEVKSAIVCASVLKDGCDVGFCPHRHKLRSRVKFVNGRVVITNVGEPIISQPSKLLNGIAYTTFSGSFDNGHYVVYDAANNAVYDGARLFSSDLSTLAVTAIVVVGGCVTSNVPTIVSEKISVMDKLDTGAQKFFQFGDFVMNNIVLFLTWLLSMFSLLRTSIMKHDIKVIAKAPKRTGVILTRSFKYNIRSALFVIKQKWCVIVTLFKFLLLLYAIYALVFMIVQFSPFNSLLCGDIVSGYEKSTFNKDIYCGNSMVCKMCLFSYQEFNDLDHTSLVWKHIRDPILISLQPFVILVILLIFGNMYLRFGLLYFVAQFISTFGSFLGFHQKQWFLHFVPFDVLCNEFLATFIVCKIVLFVRHIIVGCNNADCVACSKSARLKRVPLQTIINGMHKSFYVNANGGTCFCNKHNFFCVNCDSFGPGNTFINGDIARELGNVVKTAVQPTAPAYVIIDKVDFVNGFYRLYSGDTFWRYDFDITESKYSCKEVLKNCNVLENFIVYNNSGSNITQIKNACVYFSQLLCEPIKLVNSELLSTLSVDFNGVLHKAYVDVLCNSFFKELTANMSMAECKATLGLTVSDDDFVSAVANAHRYDVLLSDLSFNNFFISYAKPEDKLSVYDIACCMRAGSKVVNHNVLIKESIPIVWGVKDFNTLSQEGKKYLVKTTKAKGLTFLLTFNDNQAITQVPATSIVAKQGA 899 2462 92738FB33983BC7E k9n7c7-pro_0000422441 Papain-like proteinase rep ORF1ab polyprotein 1a-1b protein protein cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC APVKKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEADTEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRRVNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLNKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVRFTANKIVGG 854 2740 532E0D4BDE146A6E poly(i:c) poly(I:C) 5'-Inosinic acid, homopolymer, complex with 5'-cytidylic acid homopolymer (1:1) PI:C Poly C poly I Poly I-C poly I:C Poly I:poly C Poly IC Poly rI:poly rC Poly(cytidylic acid)-poly(inosinic acid) Poly(I).poly(C) Poly(I).poly(C) complex poly(I).poly(C) Poly(I+C) Poly(rI).(rC) Poly(rI).poly(rC) Polycytidylic-polyinosinic acid Polyinosinic acid:polycytidylic acid Polyinosinic-polycytidylic acid polyinosinic:polycytidylic acid Polyriboinosinic-polyribocytidylic acid small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK DIP protein P62136 original sequence version: 72 DIP protein P62136 original sequence version: 76 DIP protein P62136 original sequence version: 123 DIP protein P62136 original sequence version: 126 DIP protein P62136-1 original sequence version: 98 60C37E1AD9831DAC 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 p0c6x9-pro_0000037340 Papain-like proteinase rep ORF1ab polyprotein 1a-1b protein protein cvma5 Murine coronavirus (strain A59) MHV-A59 Murine hepatitis virus GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEVIAPRMYCSFSAPDDEDCVAADVVDADENQDDDAEDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEELAEPDAVGSQTPIASAEETEVGEASDREGIAEAKATVCADAVDACPDQVEAFEIEKVEDSILDELQTELNAPADKTYEDVLAFDAVCSEALSAFYAVPSDETHFKVCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDLEMQKLWLSYKAGYDQCFVDKLVKSVPKSIILPQGGYVADFAYFFLSQCSFKAYANWRCLECDMELKLQGLDAMFFYGDVVSHMCKCGNSMTLLSADIPYTLHFGVRDDKFCAFYTPRKVFRAACAVDVNDCHSMAVVEGKQIDGKVVTKFIGDKFDFMVGYGMTFSMSPFELAQLYGSCITPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKAQGVCQVGECYESAGGKLCKKVLNIVGPDARGHGKQCYSLLERAYQHINKCDNVVTTLISAGIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCRDVKFVTNACSSLFSESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDCLPTDWRLVNKFDSVDGVRTIKYFECPGGIFVSSQGKKFGYVQNGSFKEASVSQIRALLANKVDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEADLVAVKDAFGFDEPQLLKYYTMLGMCKWPVVVCGNYFAFKQSNNNCYINVACLMLQHLSLKFPKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCNLEFVCKCGVKQEQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLVHCTQFNVPFLICSNTPEGRKLPDDVVAANIFTGGSVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQYYCESGKYYTKPIIKAQFRTFEKVDGVYTNFKLVGHSIAEKLNAKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGCITFGKPVVWLGHEEASLKSLTYFNRPSVVCENKFNVLPVDVSEPTDKGPVPAAVLVTGVPGADASAGAGIAKEQKACASASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSVVVNDPTSETKVVKSLSIVDVYDMFLTGCKYVVWTANELSRLVNSPTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKVVKAKAIACYCAVKWFLLYCFSWIKFNTDNKVIYTTEVASKLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDFYQVTDLGYRSSFCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDYISLFKLVVELVIGYSLYTVCFYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYCLCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNCNSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFYERDGQRVYDDVNASLFVDMNGLLHSKVKGVPETHVVVVENEADKAGFLGAAVFYAQSLYRPMLMVEKKLITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFIGCARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAADLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNKQEANVPILTTPFSLKGG 833 2837 51398C8D075B43E9 p0c6x7-pro_0000037311 Papain-like protease nsp3 rep ORF1ab polyprotein 1a-1b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGG 819 2740 BBB1A6190358ADDE sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS DIP protein P05161 original sequence version: 130 DIP protein P05161 original sequence version: 142 DIP protein P05161 original sequence version: 155 DIP protein P05161 original sequence version: 96 DIP protein P05161 original sequence version: 141 DIP protein P05161 original sequence version: 168 DIP protein P05161 original sequence version: 150 B6858A15AB0FFFDE p0dtd1-pro_0000449621 Papain-like protease nsp3 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG 819 2763 pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK DIP protein P36873 original sequence version: 169 DIP protein P36873 original sequence version: 177 0EEEF0E842188536 v_measc Non-structural protein V P/V protein protein measc measles virus (strai MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPGQDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQASSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTLNVPPPPNPSRASTSETPIKKGHRREIGLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVCEQCRTDTGVDTRIWYHNLPEIPE DIP protein P0C774 original sequence version: 24 FEDBD36B65E382D0 ifih1_human Interferon-induced helicase C domain-containing protein 1 Helicase with 2 CARD domains Interferon-induced with helicase C domain protein 1 Melanoma differentiation-associated protein 5 Murabutide down-regulated protein RNA helicase-DEAD box protein 116 RIG-I-like receptor 2 IFIH1 MDA5 RH116 Clinically amyopathic dermatomyositis autoantigen 140 kDa protein protein human Homo sapiens Human MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIENLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTASPGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTRIQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED DIP protein Q9BYX4 original sequence version: 130 DIP protein Q9BYX4 original sequence version: 120 DIP protein Q9BYX4 original sequence version: 123 DIP protein Q9BYX4 original sequence version: 66 DIP protein Q9BYX4 original sequence version: 82 DIP protein Q9BYX4-1 original sequence version: 136 DIP protein Q9BYX4-1 original sequence version: 107 DIP protein Q9BYX4 original sequence version: 122 789CFB4824B92DC9 ifih1_mouse Interferon-induced helicase C domain-containing protein 1 Ifih1 Interferon induced with helicase C domain protein 1 Helicase with 2 CARD domains Melanoma differentiation-associated protein 5 RIG-I-like receptor 2 protein protein mouse Mus musculus Mouse MSIVCSAEDSFRNLILFFRPRLKMYIQVEPVLDHLIFLSAETKEQILKKINTCGNTSAAELLLSTLEQGQWPLGWTQMFVEALEHSGNPLAARYVKPTLTDLPSPSSETAHDECLHLLTLLQPTLVDKLLINDVLDTCFEKGLLTVEDRNRISAAGNSGNESGVRELLRRIVQKENWFSTFLDVLRQTGNDALFQELTGGGCPEDNTDLANSSHRDGPAANECLLPAVDESSLETEAWNVDDILPEASCTDSSVTTESDTSLAEGSVSCFDESLGHNSNMGRDSGTMGSDSDESVIQTKRVSPEPELQLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASESGKVIVLVNKVMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKISFPEVVKSYDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVYNNIMRRYLKQKLRNNDLKKQNKPAIPLPQILGLTASPGVGAAKKQSEAEKHILNICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIADDTRENPFKEKLLEIMASIQTYCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQINDTIRMIDAYSHLETFYTDEKEKKFAVLNDSDKSDDEASSCNDQLKGDVKKSLKLDETDEFLMNLFFDNKKMLKKLAENPKYENEKLIKLRNTILEQFTRSEESSRGIIFTKTRQSTYALSQWIMENAKFAEVGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSGSGVTEREIVNDFREKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNPSLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKALQKKFADYQTNGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVNFKNNSPKKQYKKWVELPIRFPDLDYSEYCLYSDED mint RNA helicase that, through its ATP-dependent unwinding of RNA, may function to promote message degradation by specific RNases. Seems to have growth suppressive properties. Involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). ATPase activity is specifically induced by dsRNA (By similarity). Essential for the production of interferons in response to picornaviruses 708FCAC690C9F6D8 ifih1-isg15-1 2 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Ext. Data 1A ifih1-isg15-2 4 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9BYX4:p.Lys23Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 11:59:04 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys23Arg' Q9BYX4:p.Lys43Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Q9BYX4:p.Lys68Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 10:43:01 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys68Arg' Q9BYX4:p.Lys128Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 10:16:35 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys128Arg' Q9BYX4:p.Lys137Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 13:06:38 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys137Arg' Q9BYX4:p.Lys169Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 10:45:20 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys169Arg' Q9BYX4:p.Lys174Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 12:38:10 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys174Arg' Q9BYX4:p.Lys235Arg mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 11:30:39 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys235Arg' Q9BYX4:p.[Lys23Arg;Lys43Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 11:08:04 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys23Arg;Lys43 Arg]' 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2D, Ext. Data 1B, 2C, 3A, 3D, 3F, 3H MeV-V (Uniprot P0C774) expression enhanced MDA5 Ser88 phosphorylation (indicative of ablated dephosphorylation), which correlated with a decline in ISGylation. A mutant MeV-V (MeV-V Delta tail) that does not bind PP1 and does not antagonise MDA5-dephosphorylation , exhibited little effect on MDA5–2CARD ISGylation. Either NiV-V (Uniprot Q997F2) or HeV-V (Uniprot O55777) expression also enhanced MDA5 Ser88 phosphorylation (indicative of ablated dephosphorylation), which correlated with a decline in ISGylation. ifih1-isg15-3 3 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2A, Ext. data 2A ds-poly(I:C) transfection. cells were infected with dengue (DENV) or Zika (ZIKV) viruses. Endogenous MDA5 was ISGylated in uninfected cells, although at very low levels. ifih1-isg15-4 1 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BYX4:p.[Lys23Arg;Lys43Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 11:14:48 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys23Arg;Lys43 Arg]' physical association physical association 2B, 2E, Ext. Data 2D,3E MeV-V (Uniprot P0C774) expression enhanced MDA5 Ser88 phosphorylation (indicative of ablated dephosphorylation), which correlated with a decline in ISGylation. ifih1-isg15-6 1 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BYX4:p.[Lys23Arg;Lys43Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 11:18:14 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys23Arg;Lys43 Arg]' physical association physical association Ext. Data 2E ifih1-rep-1 1 16 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined UBL_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C, number 1 ifih1-p/v-9 1 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5C, number 2 positive control ifih1-rep-2 4 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5E, Lane 4 MDA5–2CARD ISGylation was inhibited. (SARS1) These cells also expressed FLAG–ISG15, HA–Ube1L and FLAG–UbcH8. ifih1-rep-3 4 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5E, Lane 5 MDA5–2CARD ISGylation was inhibited. (MERS) These cells also expressed FLAG–ISG15, HA–Ube1L and FLAG–UbcH8. ifih1-rep-4 4 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PLP2 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5E, Lane 6 MDA5–2CARD ISGylation was inhibited. (PLP2-NL63) These cells also expressed FLAG–ISG15, HA–Ube1L and FLAG–UbcH8. ifih1-rep-5 4 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PLP2 region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5E, Lane 7 MDA5–2CARD ISGylation was inhibited. (PLP2-MHV) These cells also expressed FLAG–ISG15, HA–Ube1L and FLAG–UbcH8. ifih1-rep-6 5 16 unspecified role unspecified role prey prey infection infection 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6B ifih1-rep-7 5 15 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6C PLpro inhibitor (GRL-0617- CHEBI:167176) In infected cells treated with a specific PLpro inhibitor (GRL-0617), MDA5 ISGylation and downstream ISG induction were strongly enhanced. (In the absence of either GRL-0617 or SARS2 infection, minimal ISG15 was detected.) ifih1-isg15-9 4 10 ancillary ancillary prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Ext. Data 3A ifih1-isg15-10 4 17 ancillary ancillary prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 2CARD_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Ext. Data 3A poly(i:c)-ifih1-1 6 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. 9 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Ext. Data 4 A poly(i:c)-ifih1-2 6 9 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9BYX4:p.[Lys23Arg;Lys43Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 13:35:39 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys23Arg;Lys43Arg]' n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Ext. Data 4 B ywhah-ifih1-1 1 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BYX4:p.[Lys23Arg;Lys43Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 13:02:37 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys23Arg;Lys43Arg]' Q9BYX4:p.Lys68Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Thu Apr 22 12:51:41 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys68Arg' 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Ext. data 4C 14-3-3 eta protein taken from Ref. 47.