DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Nature structural & molecular biology 2021 imex curation Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single predetermined predetermined participant predetermined Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Accepted 2021-OCT-05 AT 11:26 BST AT 11:26 BST by ORCHARD Nature structural & molecular biology 2021 imex curation Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Nature structural & molecular biology 2021 imex curation Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Only protein-protein interactions imex curation human-293a Homo sapiens hek293a hek293a anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Accepted 2021-OCT-05 AT 11:26 BST AT 11:26 BST by ORCHARD Nature structural & molecular biology 2021 imex curation Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Cryo-EM structure of the Hippo signaling integrator human STRIPAK. Nature structural & molecular biology 2021 imex curation Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X., Jeong BC., Bae SJ., Ni L., Zhang X., Bai XC., Luo X. Xiaochen.Bai@UTSouthwestern.edu; Xuelian.Luo@UTSouthwestern.edu Accepted 2021-OCT-05 AT 11:26 BST AT 11:26 BST by ORCHARD Nature structural & molecular biology 2021 imex curation p67775-1 Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform Replication protein C PP2Acalpha1 PPP2CA protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL C602291F78F34555 q9y3a3-1 MOB-like protein phocein MOB4 2C4D Class II mMOB1 MOB3 MOBKL3 Mob1 homolog 3 Mps one binder kinase activator-like 3 PHOCN PREI3 Preimplantation protein 3 CGI-95 protein protein human Homo sapiens Human MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA D0EF1219711458BA pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL DIP protein P67775 original sequence version: 112 DIP protein P67775-1 original sequence version: 98 DIP protein P67775 original sequence version: 29 DIP protein P67775 original sequence version: 102 DIP protein P67775 original sequence version: 65 DIP protein P67775 original sequence version: 67 DIP protein P67775-1 original sequence version: 114 DIP protein P67775 original sequence version: 113 DIP protein P67775-1 original sequence version: 122 C602291F78F34555 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA DIP protein P30153 original sequence version: 153 DIP protein P30153 original sequence version: 71 DIP protein P30153 original sequence version: 105 DIP protein P30153 original sequence version: 107 DIP protein P30153 original sequence version: 151 DIP protein P30153 original sequence version: 156 DIP protein P30153 original sequence version: 155 DIP protein P30153 original sequence version: 169 5174EBE94D537836 q13033-2 Striatin-3 STRN3 GS2NA SG2NA Cell cycle autoantigen SG2NA S/G2 antigen protein protein human Homo sapiens Human MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV 8252FEA677586912 q5vsl9-1 Striatin-interacting protein 1 STRIP1 FAM40A KIAA1761 Protein FAM40A protein protein human Homo sapiens Human MEPAVGGPGPLIVNNKQPQPPPPPPPAAAQPPPGAPRAAAGLLPGGKAREFNRNQRKDSEGYSESPDLEFEYADTDKWAAELSELYSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEVTAREKRLKVARAILYVAQGTFGECSSEAEVQSWMRYNIFLLLEVGTFNALVELLNMEIDNSAACSSAVRKPAISLADSTDLRVLLNIMYLIVETVHQECEGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGMVTKFCSGHAPHFPMKKVLLLLWKTVLCTLGGFEELQSMKAEKRSILGLPPLPEDSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVREKDIEMFLESSRSKFIGYTLGSDTNTVVGLPRPIHESIKTLKQHKYTSIAEVQAQMEEEYLRSPLSGGEEEVEQVPAETLYQGLLPSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPTTVLQSMKLGVDVNRHKEVIVKAISAVLLLLLKHFKLNHVYQFEYMAQHLVFANCIPLILKFFNQNIMSYITAKNSISVLDYPHCVVHELPELTAESLEAGDSNQFCWRNLFSCINLLRILNKLTKWKHSRTMMLVVFKSAPILKRALKVKQAMMQLYVLKLLKVQTKYLGRQWRKSNMKTMSAIYQKVRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ 5F9BA1D4C7DE6925 strn3_human Striatin-3 Cell cycle autoantigen SG2NA S/G2 antigen STRN3 GS2NA SG2NA protein protein human Homo sapiens Human MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERKGKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV 2179BD257186DFB0 strp1_human Striatin-interacting protein 1 STRIP1 FAM40A KIAA1761 Protein FAM40A protein protein human Homo sapiens Human MEPAVGGPGPLIVNNKQPQPPPPPPPAAAQPPPGAPRAAAGLLPGGKAREFNRNQRKDSEGYSESPDLEFEYADTDKWAAELSELYSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEVTAREKRLKVARAILYVAQGTFGECSSEAEVQSWMRYNIFLLLEVGTFNALVELLNMEIDNSAACSSAVRKPAISLADSTDLRVLLNIMYLIVETVHQECEGDKAEWRTMRQTFRAELGSPLYNNEPFAIMLFGMVTKFCSGHAPHFPMKKVLLLLWKTVLCTLGGFEELQSMKAEKRSILGLPPLPEDSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEEEENDDDNSLEGETFPLERDEVMPPPLQHPQTDRLTCPKGLPWAPKVREKDIEMFLESSRSKFIGYTLGSDTNTVVGLPRPIHESIKTLKQHKYTSIAEVQAQMEEEYLRSPLSGGEEEVEQVPAETLYQGLLPSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPTTVLQSMKLGVDVNRHKEVIVKAISAVLLLLLKHFKLNHVYQFEYMAQHLVFANCIPLILKFFNQNIMSYITAKNSISVLDYPHCVVHELPELTAESLEAGDSNQFCWRNLFSCINLLRILNKLTKWKHSRTMMLVVFKSAPILKRALKVKQAMMQLYVLKLLKVQTKYLGRQWRKSNMKTMSAIYQKVRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ DIP protein Q5VSL9 original sequence version: 91 5F9BA1D4C7DE6925 phocn_human MOB-like protein phocein MOB4 2C4D Class II mMOB1 MOB3 MOBKL3 Mob1 homolog 3 Mps one binder kinase activator-like 3 PHOCN PREI3 Preimplantation protein 3 CGI-95 protein protein human Homo sapiens Human MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA D0EF1219711458BA mob4-ppp2ca-1 1 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 1, Table 1 mob4-ppp2ca-2 3 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig. 1b, Supp. Fig. 1a strip1-mob4-1 2 12 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 9 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag Tag Flag Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5VSL9-1:p.Lys427Glu K247E Muttation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Q5VSL9-1:p.Arg744Glu R744E mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Q5VSL9-1:p.[Asp131Lys;Glu134Lys] D131K, E134K mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D K certain certain sequence position certain certain certain sequence position certain E K Q5VSL9-1:p.Phe444Ala F444A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Q5VSL9-1:p.Pro462Ala P462A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Q5VSL9-1:p.Met733Ala M733A mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293a Homo sapiens hek293a hek293a 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a association association Fig. 3d,e; Fig. 4c, 4f, Fig. 5c, extended Fig. 7A ppp2ca-mob4-1 2 12 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 11 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 4 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P67775-1:p.Leu186Ala L186A mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P67775-1:p.Trp209Ala W209A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a association association Fig 4b ppp2ca-ppp2r1a-21 2 4 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P67775-1:p.Leu186Ala L186A mutation mutation mutation certain certain sequence position certain certain certain sequence position certain L A FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a physical association physical association Fig 4b ppp2r1a-mob4-1 2 12 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 11 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P30153:p.Val15Ala V15A mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P30153:p.Glu19Lys E19K mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K human-293a Homo sapiens hek293a hek293a association association Fig 2d ppp2r1a-ppp2ca-8 2 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P30153:p.Val15Ala V15A mutation mutation mutation certain certain sequence position certain certain certain sequence position certain V A FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P30153:p.Glu19Lys E19K mutation mutation mutation certain certain sequence position certain certain certain sequence position certain E K human-293a Homo sapiens hek293a hek293a physical association physical association Fig 2d strn3-mob4-1 2 12 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 11 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 8 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q13033:p.Arg116Glu R116E mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Q13033:p.Arg117Glu R117E mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Q13033:p.Leu121Ala L121A mutation mutation with complex effect mutation with complex effect mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293a Homo sapiens hek293a hek293a 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a association association Fig 2e, Extended Fig. 5A Interaction observed in STM1/3/4 knock-out cells mob4-strn3-1 2 5 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9Y3A3-1:p.[Arg161_Arg162delinsGluGlu;Arg165Glu] R161E, R162E, R165E mutation mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain RR EE certain certain sequence position certain certain certain sequence position certain R E Tue Oct 05 18:32:20 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9Y3A3-1:p.[Arg161Glu;Arg162Glu;Arg165Glu][165-165], [161-162]' FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293a Homo sapiens hek293a hek293a 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a physical association physical association Fig 5d mob4-ppp2ca-4 2 5 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 1-40 region 1-40 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9Y3A3-1:p.[Arg161Glu;Arg162Glu;Arg165Glu] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain RR EE certain certain sequence position certain certain certain sequence position certain R E human-293a Homo sapiens hek293a hek293a 11 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a association association Fig 5f strn3-mob4-2 2 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wd40 region required to bind necessary binding region required to bind range range range range [EBI-27101568]range positions must always be strictly superior to 0 and inferior or equal to the sequence length. Actual positions : 796-796, sequence length 713 [EBI-27101568]478-796 Q13033-2:p.Arg446Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Q13033-2:p.Met120Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M A Tue Oct 05 18:38:42 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q13033:p.Met120Ala[120-120]' 12 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293a Homo sapiens hek293a hek293a 11 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 7 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a association association Figs 2e, 5g strn3-mob4-3 2 12 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293a Homo sapiens hek293a hek293a 8 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q13033-2:p.Arg116Glu R116E mutation mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Oct 05 19:11:01 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q13033:p.Arg116Glu' Q13033-2:p.Arg117Glu R117E mutation mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R E Tue Oct 05 19:25:20 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q13033:p.Arg117Glu' Q13033-2:p.Leu121Ala L121A mutation mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Oct 05 19:04:29 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q13033:p.Leu121Ala' FLAG tag FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293a Homo sapiens hek293a hek293a physical association physical association Fig 2e