DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 2.5 Å-resolution structure of human CDK-activating kinase bound to the clinical inhibitor ICEC0942. 2.5 Å-resolution structure of human CDK-activating kinase bound to the clinical inhibitor ICEC0942. Biophysical journal 2021 imex curation Greber BJ., Remis J., Ali S., Nogales E. basil.greber@icr.ac.uk Only protein-protein interactions imex curation trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Greber BJ., Remis J., Ali S., Nogales E. basil.greber@icr.ac.uk Accepted 2021-JUL-04 AT 06:34 BST AT 06:34 BST by KALPANAP Biophysical journal 2021 Only protein-protein interactions imex curation imex curation ccnh_human Cyclin-H MO15-associated protein p37 p34 CCNH protein protein human Homo sapiens Human MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL DIP protein P51946 original sequence version: 160 DIP protein P51946 original sequence version: 113 BB48D55DA397A0E4 cdk7_human Cyclin-dependent kinase 7 CDK7 MO15 CAK CAK1 TFIIH basal transcription factor complex kinase subunit 39 kDa protein kinase CDKN7 STK1 Cell division protein kinase 7 CDK-activating kinase 1 Serine/threonine-protein kinase 1 protein protein human Homo sapiens Human MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF DIP protein P50613 original sequence version: 126 DIP protein P50613 original sequence version: 78 0A94BFA7DD416CEB mat1_human CDK-activating kinase assembly factor MAT1 RING finger protein MAT1 Menage a trois CDK7/cyclin-H assembly factor p36 p35 Cyclin-G1-interacting protein RING finger protein 66 MNAT1 CAP35 MAT1 RNF66 protein protein human Homo sapiens Human MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHKLEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDAFSGLFWQPS 6818DDE230E81A97 ccnh-cdk7-3 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association Fig 1, Fig S1, Table 1