IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. Cell reports 2020 imex curation Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins ACE2 has been assumed to be of Human origin; this has not been confirmed by the authors who did not reply to a request for information. Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu Accepted 2021-JAN-26 AT 16:59 GMT AT 16:59 GMT by KALPANAP Cell reports 2020 Only protein-protein interactions imex curation imex curation D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. Cell reports 2020 imex curation Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu Accepted 2021-JAN-26 AT 16:59 GMT AT 16:59 GMT by KALPANAP Cell reports 2020 Only protein-protein interactions imex curation imex curation D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. Cell reports 2020 imex curation Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 3d-em 3D electron microscopy 3D-EM electron tomog structure determination identification by structure determination identification by structure determination structure determination Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu Accepted 2021-JAN-26 AT 16:59 GMT AT 16:59 GMT by KALPANAP Cell reports 2020 Only protein-protein interactions imex curation imex curation D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. D614G Mutation Alters SARS-CoV-2 Spike Conformation and Enhances Protease Cleavage at the S1/S2 Junction. Cell reports 2020 imex curation Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P., Gobeil SM., Janowska K., McDowell S., Mansouri K., Parks R., Manne K., Stalls V., Kopp MF., Henderson R., Edwards RJ., Haynes BF., Acharya P. Virus - Publications including interactions involving viral proteins Email sent regarding species of ACE2.15/1/21. NO reply. SDS page results (figure 2,3 +more) not entered as M. Wt indicates a monomer. Addgene plasmids still not yet visible on web site. (25/1/21) This publication was previously pmid:33052347. priyamvada.acharya@duke.edu Accepted 2021-JAN-26 AT 16:59 GMT AT 16:59 GMT by KALPANAP Cell reports 2020 Only protein-protein interactions imex curation imex curation ace2_human Angiotensin-converting enzyme 2 ACE2 UNQ868/PRO1885 Angiotensin-converting enzyme homolog Metalloprotease MPROT15 Angiotensin-converting enzyme-related carboxypeptidase protein protein human Homo sapiens Human MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF mint Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses 8EE6EB0A931550E8 furin_human Furin FURIN FUR PACE PCSK3 Paired basic amino acid residue-cleaving enzyme Dibasic-processing enzyme protein protein human Homo sapiens Human MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQIFGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCEEGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCLSCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEGRGERTAFIKDQSAL DIP protein P09958 original sequence version: 107 10C44DD5892EF85D spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT p03303-pro_0000426549 Protease 3C protein protein hrv14 Human rhinovirus 14 GPNTEFALSLLRKNIMTITTSKGEFTGLGIHDRVCVIPTHAQPGDDVLVNGQKIRVKDKYKLVDPENINLELTVLTLDRNEKFRDIRGFISEDLEGVDATLVVHSNNFTNTILEVGPVTMAGLINLSSTPTNRMIRYDYATKTGQCGGVLCATGKIFGIHVGGNGRQGFSAQLKKQYFVEKQ 1538 1719 DDC60C17418E36F5 s-61 3 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Asp614Gly;Arg682_Arg683delinsGlySer;Arg685Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain D G certain certain sequence position certain certain certain sequence position certain RR GS certain certain sequence position certain certain certain sequence position certain R S Mon Mar 01 11:21:29 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Arg682_Arg683delinsGlySer;Arg685Ser;Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Table S1 all these PDBe entries have an identical sequence s-63 3 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg682_Arg683delinsGlySer;Arg685Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain RR GS certain certain sequence position certain certain certain sequence position certain R S C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Table S1 s-64 3 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.Asp614Gly mutation mutation certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:00:17 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Table S1 s-65 3 7 unspecified role unspecified role neutral component neutral component purified purified P0DTC2:p.[Gln607Glu;Asp614Gly] mutation mutation certain certain sequence position certain certain certain sequence position certain D G certain certain sequence position certain certain certain sequence position certain Q E Mon Mar 01 11:01:17 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly;Gln607Glu]' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Table S1 s-66 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg682_Arg683delinsGlySer;Arg685Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain RR GS certain certain sequence position certain certain certain sequence position certain R S P0DTC2:p.Asp614Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:32:37 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Asp614Gly;Lys986_Val987delinsProPro] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KV PP certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:00:15 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Lys986_Val987delinsProPro;Asp614Gly]' direct interaction direct interaction Figure 2A, 3A s-ace2-61 1 5 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg682_Arg683delinsGlySer;Arg685Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain RR GS certain certain sequence position certain certain certain sequence position certain R S C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.Lys986_Val987delinsProPro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KV PP human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 2D s-67 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.Arg682_Arg685delinsLeuGluValLeuPheGlnGlyPro mutation mutation certain certain sequence position certain certain certain sequence position certain RRAR LEVLFQGP P0DTC2:p.Asp614Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:25:12 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Figure 5A s-ace2-62 1 5 unspecified role unspecified role prey prey purified purified region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.[Arg682_Arg683delinsGlySer;Arg685Ser] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain RR GS certain certain sequence position certain certain certain sequence position certain R S P0DTC2:p.Asp614Gly mutation mutation certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:50:46 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction 7B s-68 2 8 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.Arg682_Arg685delinsLeuGluValLeuPheGlnGlyPro mutation mutation certain certain sequence position certain certain certain sequence position certain RRAR LEVLFQGP P0DTC2:p.Asp614Gly mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:32:32 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f protein cleavage protein cleavage Figure 5 E/F/G s-69 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Figure 6A SEC profiles (Figure 6 A) showed a higher proportion of the first higher-molecular-weight peak (at elution volume ~10ml). The SEC profile of the S-RRAR S preparation showed small populations of lower-molecular-weight peaks (~44kDa) that were not observed for the S-RRAR/D614G protein. s-70 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.Asp614Gly mutation mutation certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 11:30:12 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Figure 6 A/F SEC profiles (Figure 6A) showed a higher proportion of the first higher-molecular-weight peak (at elution volume ~10ml). Smaller molecular weight bands corresponding to the S1 and S2 subunits were seen in higher proportions in the S-RRAR/D614G S preparation compared with the S-RRAR preparation. Figure 6F shows the Furin digested S-RRAR/D614G ectodomain. s-71 2 6 enzyme enzyme neutral component neutral component purified purified possible soluble region sufficient to bind sufficient binding region sufficient to bind range range range range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0DTC2:p.Asp614Gly mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain D G Mon Mar 01 10:50:24 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P0DTC2:p.[Asp614Gly]' C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range foldon trimerization tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range HRV3C protease cleavage site tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f protein cleavage protein cleavage Figure 6E (G/H)