IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro uv-vis ultraviolet-visible spectroscopy uv-vis predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Turbidity measured at 340 nm. david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro light microscopy light microscopy predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro frap fluorescence recovery after photobleaching frap predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined NaCl molar molar M M 1.0 0.150 Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Phosphoregulation of Phase Separation by the SARS-CoV-2 N Protein Suggests a Biophysical Basis for its Dual Functions. Molecular cell 2020 imex curation Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus david.morgan@ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) light microscopy light microscopy predetermined predetermined participant predetermined Carlson CR., Asfaha JB., Ghent CM., Howard CJ., Hartooni N., Safari M., Frankel AD., Morgan DO. Virus - Publications including interactions involving viral proteins david.morgan@ucsf.edu Accepted 2021-APR-07 AT 06:23 BST AT 06:23 BST by KALPANAP Molecular cell 2020 Only protein-protein interactions imex curation imex curation luc-170 1710 nt firefly luciferase rna ribonucleic acid RNA rna in vitro In vitro GGUCUAGAAAUAAUUUUGUUUAACUUUAAGAAGGAGAUAUAACCAUGAAAAUCGAAGAAGGUAAAGGUCACCAUCACCAUCACCACGGAUCCAUGGAAGACGCCAAAAACAUAAAGAAAGGCCCGGCGCCAUUCUAUCCUCUAGAGGAUGGAACCGCUGGAGAGCAACUGCAUAAGGCUAUGAAGAGAUACGCCCUGGUUCCUGGAACAAUUGCUUUUACAGAUGCACAUAUCGAGGUGAACAUCACGUACGCGGAAUACUUCGAAAUGUCCGUUCGGUUGGCAGAAGCUAUGAAACGAUAUGGGCUGAAUACAAAUCACAGAAUCGUCGUAUGCAGUGAAAACUCUCUUCAAUUCUUUAUGCCGGUGUUGGGCGCGUUAUUUAUCGGAGUUGCAGUUGCGCCCGCGAACGACAUUUAUAAUGAACGUGAAUUGCUCAACAGUAUGAACAUUUCGCAGCCUACCGUAGUGUUUGUUUCCAAAAAGGGGUUGCAAAAAAUUUUGAACGUGCAAAAAAAAUUACCAAUAAUCCAGAAAAUUAUUAUCAUGGAUUCUAAAACGGAUUACCAGGGAUUUCAGUCGAUGUACACGUUCGUCACAUCUCAUCUACCUCCCGGUUUUAAUGAAUACGAUUUUGUACCAGAGUCCUUUGAUCGUGACAAAACAAUUGCACUGAUAAUGAAUUCCUCUGGAUCUACUGGGUUACCUAAGGGUGUGGCCCUUCCGCAUAGAACUGCCUGCGUCAGAUUCUCGCAUGCCAGAGAUCCUAUUUUUGGCAAUCAAAUCAUUCCGGAUACUGCGAUUUUAAGUGUUGUUCCAUUCCAUCACGGUUUUGGAAUGUUUACUACACUCGGAUAUUUGAUAUGUGGAUUUCGAGUCGUCUUAAUGUAUAGAUUUGAAGAAGAGCUGUUUUUACGAUCCCUUCAGGAUUACAAAAUUCAAAGUGCGUUGCUAGUACCAACCCUAUUUUCAUUCUUCGCCAAAAGCACUCUGAUUGACAAAUACGAUUUAUCUAAUUUACACGAAAUUGCUUCUGGGGGCGCACCUCUUUCGAAAGAAGUCGGGGAAGCGGUUGCAAAACGCUUCCAUCUUCCAGGGAUACGACAAGGAUAUGGGCUCACUGAGACUACAUCAGCUAUUCUGAUUACACCCGAGGGGGAUGAUAAACCGGGCGCGGUCGGUAAAGUUGUUCCAUUUUUUGAAGCGAAGGUUGUGGAUCUGGAUACCGGGAAAACGCUGGGCGUUAAUCAGAGAGGCGAAUUAUGUGUCAGAGGACCUAUGAUUAUGUCCGGUUAUGUAAACAAUCCGGAAGCGACCAACGCCUUGAUUGACAAGGAUGGAUGGCUACAUUCUGGAGACAUAGCUUACUGGGACGAAGACGAACACUUCUUCAUAGUUGACCGCUUGAAGUCUUUAAUUAAAUACAAAGGAUAUCAGGUGGCCCCCGCUGAAUUGGAAUCGAUAUUGUUACAACACCCCAACAUCUUCGACGCGGGCGUGGCAGGUCUUCCCGACGAUGACGCCGGUGAACUUCCCGCCGCCGUUGUUGUUUUGGAGCACGGAAAGACGAUGACGGAAAAAGAGAUCGUGGAUUACGUCGCCAGUCAAGUAACAACCGCGAAAAAGUUGCGCGGAGGAGUUGUGUUUGUGGACGAAGUACCGAAAGGUCUUACCGGAAAACUCGACGCAAGAAAAAUCAGAGAGAUCCUCAUAAAGGCCAAGAAGGGCGGAAAGUCCAAACUCGAGUAAGGUUAACCUGCAGGAGG gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 ccnb1_human G2/mitotic-specific cyclin-B1 CCNB1 CCNB protein protein human Homo sapiens Human MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV DIP protein P14635 original sequence version: 146 DIP protein P14635 original sequence version: 108 DIP protein P14635 original sequence version: 145 DIP protein P14635 original sequence version: 139 E2C4767AE8A11EC0 ps-318 rna ribonucleic acid RNA rna in vitro In vitro UGAGCUUUGGGCUAAGCGUAACAUUAAACCAGUGCCAGAGAUUAAGAUACUCAAUAAUUUGGGUGUUGAUAUCGCUGCUAAUACUGUACAUCUGGGACUACAAAAGAGAAGCCCCAGCACAUGUAUCUACAAUAGGUGUCUGCACAAUGACUGACAUUGCCAAGAAACCUACUGAGAGUGCUUGUUCUUCACUUACUGUCUUGUUUGAUGGUAGAGUGGAAGGACAGGUAGACCUUUUUAGAAACGCCCGUAAUGGUGUUUUAAUAACAGAAGGUUCAGUCAAAGGUCUAACACCUUCAAAGGGACCAGCACAAGCUA trs-10 rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) UCUAAACGAA n-1260 rna ribonucleic acid RNA rna in vitro In vitro GGGAAUUGUGAGCGGAUAACAAUUCCCCUCUAGAAAUAAUUUUGUUUAACUUUAAGAAGGAGAUAUACCAUGGGCAGCAGCCAUCAUCAUCAUCAUCACAGCAGCGGCCUGGUGCCGCGCGGUACCACGGAAAACCUGUAUUUUCAGGGAUCCAUGUCUGAUAAUGGACCCCAAAAUCAGCGAAAUGCACCCCGCAUUACGUUUGGUGGACCCUCAGAUUCAACUGGCAGUAACCAGAAUGGAGAACGCAGUGGGGCGCGAUCAAAACAACGUCGGCCCCAAGGUUUACCCAAUAAUACUGCGUCUUGGUUCACCGCUCUCACUCAACAUGGCAAGGAAGACCUUAAAUUCCCUCGAGGACAAGGCGUUCCAAUUAACACCAAUAGCAGUCCAGAUGACCAAAUUGGCUACUACCGAAGAGCUACCAGACGAAUUCGUGGUGGUGACGGUAAAAUGAAAGAUCUCAGUCCAAGAUGGUAUUUCUACUACCUAGGAACUGGGCCAGAAGCUGGACUUCCCUAUGGUGCUAACAAAGACGGCAUCAUAUGGGUUGCAACUGAGGGAGCCUUGAAUACACCAAAAGAUCACAUUGGCACCCGCAAUCCUGCUAACAAUGCUGCAAUCGUGCUACAACUUCCUCAAGGAACAACAUUGCCAAAAGGCUUCUACGCAGAAGGGAGCAGAGGCGGCAGUCAAGCCUCUUCUCGUUCCUCAUCACGUAGUCGCAACAGUUCAAGAAAUUCAACUCCAGGCAGCAGUAGGGGAACUUCUCCUGCUAGAAUGGCUGGCAAUGGCGGUGAUGCUGCUCUUGCUUUGCUGCUGCUUGACAGAUUGAACCAGCUUGAGAGCAAAAUGUCUGGUAAAGGCCAACAACAACAAGGCCAAACUGUCACUAAGAAAUCUGCUGCUGAGGCUUCUAAGAAGCCUCGGCAAAAACGUACUGCCACUAAAGCAUACAAUGUAACACAAGCUUUCGGCAGACGUGGUCCAGAACAAACCCAAGGAAAUUUUGGGGACCAGGAACUAAUCAGACAAGGAACUGAUUACAAACAUUGGCCGCAAAUUGCACAAUUUGCCCCCAGCGCUUCAGCGUUCUUCGGAAUGUCGCGCAUUGGCAUGGAAGUCACACCUUCGGGAACGUGGUUGACCUACACAGGUGCCAUCAAAUUGGAUGACAAAGAUCCAAAUUUCAAAGAUCAAGUCAUUUUGCUGAAUAAGCAUAUUGACGCAUACAAAACAUUCCCACCAACAGAGCCUAAAAAGGACAAAAAGAAGAAGGCUGAUGAAACUCAAGCCUUACCGCAGAGACAGAAGAAACAGCAAACUGUGACUCUUCUUCCUGCUGCAGAUUUGGAUGAUUUCUCCAAACAAUUGCAACAAUCCAUGAGCAGUGCUGACUCAACUCAGGCCUAAGAAUUCGAGCUCCGUCGACA p0dtc1-pro_0000449637 Papain-like protease nsp3 ORF1a polyprotein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG 819 2763 FFFD2D956385E317 5'-400 rna ribonucleic acid RNA rna in vitro In vitro AUUAAAGGUUUAUACCUUCCCAGGUAACAAACCAACCAACUUUCGAUCUCUUGUAGAUCUGUUCUCUAAACGAACUUUAAAAUCUGUGUGGCUGUCACUCGGCUGCAUGCUUAGUGCACUCACGCAGUAUAAUUAAUAACUAAUUACUGUCGUUGACAGGACACGAGUAACUCGUCUAUCUUCUGCAGGCUGCUUACGGUUUCGUCCGUGUUGCAGCCGAUCAUCAGCACAUCUAGGUUUCGUCCGGGUGUGACCGAAAGGUAAGAUGGAGAGCCUUGUCCCUGGUUUCAACGAGAAAACACACGUCCAACUCAGUUUGCCUGUUUUACAGGUUCGCGACGUGCUCGUACGUGGCUUUGGAGACUCCGUGGAGGAGGUCUUAUCAGAGGCACGUCAACAU cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM DIP protein P06493 original sequence version: 185 DIP protein P06493 original sequence version: 162 DIP protein P06493 original sequence version: 184 DIP protein P06493 original sequence version: 97 DIP protein P06493 original sequence version: 192 942D79448EFE490A ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA random-10-rna rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) NNNNNNNNNN n-n-41 3 16 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B "Native" N protein (with incomplete removal of RNA). n-n-42 12 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 1B, Supp. figure 2B "Native" N protein (with incomplete removal of RNA)- a few microscopic structures can be seen in the absence of additional RNA. 5'_400-n-1 3 20 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B "Native" N protein (with incomplete removal of RNA). n-ps_318-1 3 18 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B "Native" N protein (with incomplete removal of RNA). luc_170-n-1 3 13 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B "Native" N protein (with incomplete removal of RNA). Inclusion of luc-170 as a nonviral control. n-trs_10-1 3 17 unspecified role unspecified role neutral component neutral component partially purified partially purified region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B "Native" N protein (with incomplete removal of RNA). 5'_400-n-2 3 20 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C, 2A, 3D-F, 4 A/B, Supp. figure 2E/F, 3,4B Purified N protein (with more complete removal of RNA). figure S2D does not look very purified to me, as there are lots of extra bands - so have entered the protein as "purified" with the comment "more complete removal of RNA", which is suitably ambiguous.Figure s4B: no way of telling from light microscope images if the GFP molecule is present or not. Structures seen depended on relative RNA and protein concentrations. No deletions of any region of the N protein completely prevented droplet formation at high protein concentrations. CTE deletion (aas 365-419) stimulated the formation of abundant filaments. Phosphorylation in the SR region appears to promote the formation of more liquid-like condensates. The 10D mutation had an impact on condensate morphology. (figure 4) The filamentous structures of the wild-type protein remained relatively immobile and fused slowly, as compared to the 10D mutant and phosphorylated N protein. n-trs_10-2 3 22 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser176_Arg209delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyThrAspProAlaArg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain SRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPAR DRGGDQASDRDSDRDRNSDRNSDPGSDRGTDPAR Thu Apr 22 11:47:26 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser176_Ser206delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyTheAsp' SR region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 unspecified role unspecified role neutral component neutral component partially purified partially purified region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1C, 2A, 3E Purified N protein (with more complete removal of RNA). CTE deletion (aas 365-419) stimulated the formation of abundant filaments, and NTE region deletions (aas 1-44) inhibited it. n-random_10_rna-1 3 23 unspecified role unspecified role neutral component neutral component partially purified partially purified chemical synthesis Chemical synthesis (Chemical synthesis) 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1C Purified N protein (with more complete removal of RNA). n-n-43 5 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 6 Supp. figure 2A "Native" N protein (with incomplete removal of RNA). n-n-44 5 22 unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 7 Supp. figure 2A "Native" N protein (with incomplete removal of RNA). n-ps_318-2 3 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser176_Arg209delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyThrAspProAlaArg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPAR DRGGDQASDRDSDRDRNSDRNSDPGSDRGTDPAR Thu Apr 22 12:02:16 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser176_Ser206delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyTheAsp' ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro direct interaction direct interaction Supp. figure 2G, 4A 250mm NaCl n-n-45 2 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction 4 D/E Two-dimensional classification of the particles revealed a uniform size and architecture;the 10D mutant formed nonuniform structures. 5'_400-n-3 1 20 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2B Purified N protein (with more complete removal of RNA). CTE deletion (aas 365-419) reduced the saturating concentration and NTE deletion (aas 1-44) increased it. cyclinb1_cdk1_human-n-1 8 22 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range probable priming phosphorylation site opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P0DTC9:p.Ser206Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 10:42:56 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser206Ala' SR region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain phosphorylation site phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 113 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 115 n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 115 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation 3 B/C cyclinb1_cdk1_human-n-2 8 113 putative self putative self putative self putative self purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation true 3B cyclinb1_cdk1_human-n-3 8 14 stimulator stimulator neutral component neutral component purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 22 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range probable priming phosphorylation site opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P0DTC9:p.Ser206Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 10:40:21 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser206Ala' SR region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain phosphorylation site phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 113 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation 3 B/C cyclinb1_cdk1_human-gsk3b-1 8 14 enzyme enzyme neutral component neutral component purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 22 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser206Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 13:03:15 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser206Ala' SR region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain phosphorylation site phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3 B/C weak interaction 5'_400-n-4 4 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser176_Ser206delinsAspArgGlyGlyAspnullGlnAlaSerAspnullArgAspSerAspArgAspnullnullArgAsnSerAspArgAsnSernullAspProGlySernullAspArgGlyThrAsp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain SRGGSQASSRSSSRSRNSSRNSTPGSSRGTS DRGGD QASD RDSDRD RNSDRNS DPGS DRGTD Thu Apr 22 11:21:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser176_Ser206delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyTheAsp' region alexa 488 label alexa 488 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro direct interaction direct interaction 4C, Supp. figure 4C Purified N protein (with more complete removal of RNA). 10D mutant droplets recovered more uniformly and about 2-fold more rapidly than Wild-type. more rapid Frap recovery indicates a "mutation decreasing" but may be too simplistic here - should be a "mutation of complex -effect?" n-n-46 9 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role neutral component neutral component in vitro In vitro direct interaction direct interaction 4 D/E Two-dimensional classification of the WT particles revealed a uniform size and architecture;the mixture of 10D mutant and RNA formed nonuniform, poorly defined chains. n-n_1260-1 3 18 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser176_Arg209delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyThrAspProAlaArg mutation mutation certain certain sequence position certain certain certain sequence position certain SRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPAR DRGGDQASDRDSDRDRNSDRNSDPGSDRGTDPAR Thu Apr 22 11:36:57 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser176_Ser206delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyTheAsp' ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 4A luc_170-n-2 3 13 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0DTC9:p.Ser176_Arg209delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyThrAspProAlaArg mutation mutation certain certain sequence position certain certain certain sequence position certain SRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPAR DRGGDQASDRDSDRDRNSDRNSDPGSDRGTDPAR Thu Apr 22 13:18:15 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser176_Ser206delinsAspArgGlyGlyAspGlnAlaSerAspArgAspSerAspArgAspArgAsnSerAspArgAsnSerAspProGlySerAspArgGlyTheAsp' ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. figure 4A 5'_400-n-5 10 19 unspecified role unspecified role neutral component neutral component purified purified N-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component partially purified partially purified in vitro In vitro 22 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus sumo tag sumo tag SUMO tag sumo tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Supp. figure 4B Purified N protein (with more complete removal of RNA). The Nsp3 protein is stated to be aas 1-110 of the 1A protein;using Uniprot identifier P0DTC1 for the 1A protein this sequence corresponds to aas 819-928, NOT aas 819-920 as stated. cyclinb1_cdk1_human Cyclin B1: CDK1 Cyclin B1: CDC2 complex Maturation promoting factor MPF Cyclin B1-CDK1 complex CCNB1:CDK1 15 unspecified role unspecified role cdk1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 enzyme enzyme ccnb1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 177 179 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Cyclin-dependent protein kinase complex. Required for G2 to M phase transition of the mitotic cell cycle. Complex formation enables substrate binding to the kinase, leads to a rearrangement of the catalytic site and exposes Thr-161 of CDK1 for phosphorylation and subsequent activation. Heterodimer created with intact-jami-dbscripts