MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders For Immunofluorescence in MEFs cells rabbit anti-hnRNP H2 antibody has been used. anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders For immunoblotting in mouse brain rabbit anti-hnRNP H antibody has been used. anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders For Immunofluorescence in MEFs cells rabbit anti-hnRNP H2 antibody has been used. anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. Genetic modifiers ameliorate endocytic and neuromuscular defects in a model of spinal muscular atrophy. BMC biology 2020 imex curation Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-motor_neuron Mouse motor neuron motor_neuron motor neuron fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Walsh MB., Janzen E., Wingrove E., Hosseinibarkooie S., Muela NR., Davidow L., Dimitriadi M., Norabuena EM., Rubin LL., Wirth B., Hart AC. Brain Disease - Neurological Diseases & Disorders anne_hart@brown.edu Accepted 2021-FEB-03 AT 07:27 GMT AT 07:27 GMT by ORCHARD BMC biology 2020 Only protein-protein interactions imex curation imex curation hnrh2_mouse Heterogeneous nuclear ribonucleoprotein H2 Hnrnph2 Hnrph2 Heterogeneous nuclear ribonucleoprotein H' protein protein mouse Mus musculus Mouse MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA 2ED0A7A87A7EDF5E smn_human Survival motor neuron protein SMN1 SMN SMNT SMN2 SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN DIP protein Q16637 original sequence version: 129 DIP protein Q16637-1 original sequence version: 185 DIP protein Q16637 original sequence version: 182 DIP protein Q16637 original sequence version: 149 8A9A2A94192DCB9B hnrpf_mouse Heterogeneous nuclear ribonucleoprotein F Hnrnpf Hnrpf protein protein mouse Mus musculus Mouse MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVELESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLDRMRSGAYSAGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD 31E1C9C90A8E051F hnrh1_mouse Heterogeneous nuclear ribonucleoprotein H Hnrnph1 Hnrph Hnrph1 protein protein mouse Mus musculus Mouse MMLGAEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDFQSNIA BF6138CA982D5484 plst_human Plastin-3 T-plastin PLS3 protein protein human Homo sapiens Human MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV 631E6F803DC56A56 hnrpf_human Heterogeneous nuclear ribonucleoprotein F HNRNPF HNRPF Nucleolin-like protein mcs94-1 protein protein human Homo sapiens Human MMLGPEGGEGFVVKLRGLPWSCSVEDVQNFLSDCTIHDGAAGVHFIYTREGRQSGEAFVELGSEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRYIEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKATENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELFLNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD DIP protein P52597 original sequence version: 152 D14E170631FB1F31 plst_mouse Plastin-3 Pls3 T-plastin protein protein mouse Mus musculus Mouse MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMVDGDRNKDGKISFNEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV FEC5AA91DB963286 hnrh2_human Heterogeneous nuclear ribonucleoprotein H2 HNRNPH2 FTP3 HNRPH2 Heterogeneous nuclear ribonucleoprotein H' FTP-3 protein protein human Homo sapiens Human MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA C892523A638F07C7 smn_mouse Survival motor neuron protein Smn1 Smn protein protein mouse Mus musculus Mouse MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN 757B3074649F7458 hnrnph2-1 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association F5A SF3 Pretreatment with RNase had no impact on co-immunoprecipitation of PLS3 or SMN from HEK293T cells using GFP tagged hnRNP F or hnRNP H1/2. hnrnpf-pls3-1 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association F5A SF3 Pretreatment with RNase had no impact on co-immunoprecipitation of PLS3 or SMN from HEK293T cells using GFP tagged hnRNP F or hnRNP H1/2. hnrnph2-pls3-1 2 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F5D Pretreatment with RNase had no impact on co-immunoprecipitation of PLS3 or SMN from HEK293T cells using GFP tagged hnRNP F or hnRNP H1/2. For immunoblotting in HEK293T cells rabbit anti-hnRNP H2 antibody has been used. hnrnpf-7 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association F5B smn1-hnrnpf-1 3 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association F3C hnrnpf-pls3-2 1 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4A hnrnpf-pls3-3 5 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4B hnrnph2-pls3-2 1 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell V5 tag V5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4C hnrnph2-smn1-1 5 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4D hnrnpf-smn1-1 6 9 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4F hnrnpf-smn1-2 6 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4E pls3-smn1-1 6 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4G For Immunofluorescence in primary motor neuron rabbit anti-hnRNP H antibody has been used.