UniProt UniProt http://www.uniprot.org An intramembrane chaperone complex facilitates membrane protein biogenesis. An intramembrane chaperone complex facilitates membrane protein biogenesis. Nature 2020 imex curation Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. I've not included the data in Fig. 1-c & Fig. 4 because I think the bait is a fusion protein "Sequences encoding 1×Flag-Rho TM1+2 and 1×Flag-Rho TM1+2 (F53C) were ordered as gene blocks (IDT) and inserted into a parent vector containing an SP6 promoter and the flexible N terminus of Sec61β with a 6×His tag appended to the C terminus.' - as SEC61A and B are listed as prey, its presence in the bait fusion seems a bit dodgy so I didn't feel I could just ignore it. In fact, I've not captured anything from Fig. 1 as PAT10 does not seem to have been identified as Asterix until Fig. 2, other than by mol. wt. rhegde@mrc-lmb.cam.ac.uk Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. I've not included the data in Fig. 1-c & Fig. 4 because I think the bait is a fusion protein "Sequences encoding 1×Flag-Rho TM1+2 and 1×Flag-Rho TM1+2 (F53C) were ordered as gene blocks (IDT) and inserted into a parent vector containing an SP6 promoter and the flexible N terminus of Sec61β with a 6×His tag appended to the C terminus.' - as SEC61A and B are listed as prey, its presence in the bait fusion seems a bit dodgy so I didn't feel I could just ignore it. In fact, I've not captured anything from Fig. 1 as PAT10 does not seem to have been identified as Asterix until Fig. 2, other than by mol. wt. rhegde@mrc-lmb.cam.ac.uk Accepted 2021-NOV-22 AT 17:44 GMT AT 17:44 GMT by SIMONA Nature 2020 IMEx An intramembrane chaperone complex facilitates membrane protein biogenesis. An intramembrane chaperone complex facilitates membrane protein biogenesis. Nature 2020 imex curation Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. I've not included the data in Fig. 1-c & Fig. 4 because I think the bait is a fusion protein "Sequences encoding 1×Flag-Rho TM1+2 and 1×Flag-Rho TM1+2 (F53C) were ordered as gene blocks (IDT) and inserted into a parent vector containing an SP6 promoter and the flexible N terminus of Sec61β with a 6×His tag appended to the C terminus.' - as SEC61A and B are listed as prey, its presence in the bait fusion seems a bit dodgy so I didn't feel I could just ignore it. In fact, I've not captured anything from Fig. 1 as PAT10 does not seem to have been identified as Asterix until Fig. 2, other than by mol. wt. rhegde@mrc-lmb.cam.ac.uk Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Chitwood PJ., Hegde RS., Chitwood PJ., Hegde RS. I've not included the data in Fig. 1-c & Fig. 4 because I think the bait is a fusion protein "Sequences encoding 1×Flag-Rho TM1+2 and 1×Flag-Rho TM1+2 (F53C) were ordered as gene blocks (IDT) and inserted into a parent vector containing an SP6 promoter and the flexible N terminus of Sec61β with a 6×His tag appended to the C terminus.' - as SEC61A and B are listed as prey, its presence in the bait fusion seems a bit dodgy so I didn't feel I could just ignore it. In fact, I've not captured anything from Fig. 1 as PAT10 does not seem to have been identified as Asterix until Fig. 2, other than by mol. wt. rhegde@mrc-lmb.cam.ac.uk Accepted 2021-NOV-22 AT 17:44 GMT AT 17:44 GMT by SIMONA Nature 2020 IMEx ccd47_human PAT complex subunit CCDC47 CCDC47 Calumin Coiled-coil domain-containing protein 47 GK001 MSTP041 PSEC0077 protein protein human Homo sapiens Human MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSVTESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEILMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQENEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM 2C77CB7359B6A857 aster_human PAT complex subunit Asterix WDR83OS WD repeat domain 83 opposite strand WDR83 opposite strand CGI-140 My006 PTD008 C19orf56 Protein associated with the ER translocon of 10kDa protein protein human Homo sapiens Human MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW 7D2BDDAF9279071B ccdc47-wdr83os-1 2 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 2A ccdc47-wdr83os-2 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 2D