UniProt UniProt http://www.uniprot.org The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The Journal of biological chemistry 2019 imex curation Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Accepted 2021-NOV-15 AT 11:12 GMT AT 11:12 GMT by MGT The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The Journal of biological chemistry 2019 imex curation Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Accepted 2021-NOV-15 AT 11:12 GMT AT 11:12 GMT by MGT The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The Journal of biological chemistry 2019 imex curation Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Accepted 2021-NOV-15 AT 11:12 GMT AT 11:12 GMT by MGT The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The Journal of biological chemistry 2019 imex curation Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 proximity-dependent biotin identification proximity-dependent biotin identification sequence tag sequence tag identification sequence tag Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Accepted 2021-NOV-15 AT 11:12 GMT AT 11:12 GMT by MGT The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The E3 ubiquitin ligase MARCH2 regulates ERGIC3-dependent trafficking of secretory proteins. The Journal of biological chemistry 2019 imex curation Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Yoo W., Cho EB., Kim S., Yoon JB., Yoo W., Cho EB., Kim S., Yoon JB. The colocalisationmutations are complicated as they effect localisation rather than the strength of any interaction - I've just done them as no effect. yoonj@yonsei.ac.kr Accepted 2021-NOV-15 AT 11:12 GMT AT 11:12 GMT by MGT The Journal of biological chemistry 2019 Only protein-protein interactions imex curation imex curation ergi2_human Endoplasmic reticulum-Golgi intermediate compartment protein 2 ERGIC2 ERV41 PTX1 CDA14 protein protein human Homo sapiens Human MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWMKYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSLQDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAALVNHESYNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIINHAAGSHGVSGIFMKYDLSSLMVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLGSYKPVNSVPFEDGHTDNHLPLLENNTH 3820FA05515634ED marh2_human E3 ubiquitin-protein ligase MARCHF2 MARCHF2 MARCH2 Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II RING finger protein 172 RING-type E3 ubiquitin transferase MARCHF2 RNF172 HSPC240 protein protein human Homo sapiens Human MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV FBD877D55211C929 hpt_human Haptoglobin HP Zonulin protein protein human Homo sapiens Human MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN A98B56B2B1BE891E a1at_human Alpha-1-antitrypsin Alpha-1 protease inhibitor Alpha-1-antiproteinase AAT PI PRO0684 PRO2209 SERPINA1 Serpin A1 protein protein human Homo sapiens Human MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK DIP protein P01009 original sequence version: 186 DIP protein P01009-1 original sequence version: 182 7016555F273B7F16 ergi3_human Endoplasmic reticulum-Golgi intermediate compartment protein 3 Serologically defined breast cancer antigen NY-BR-84 ERGIC3 C20orf47 CGI-54 PRO0989 ERV46 SDBCAG84 protein protein human Homo sapiens Human MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT 8370FB3067AD95CE ergi1_human Endoplasmic reticulum-Golgi intermediate compartment protein 1 ER-Golgi intermediate compartment 32 kDa protein ERGIC1 KIAA1181 HT034 ERGIC32 protein protein human Homo sapiens Human MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINKVPGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITVKYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKMH 5B13C7B8B9F8E51D lman1_human Protein ERGIC-53 LMAN1 ERGIC53 F5F8D ER-Golgi intermediate compartment 53 kDa protein Lectin mannose-binding 1 Gp58 Intracellular mannose-specific lectin MR60 protein protein human Homo sapiens Human MAGSRQRGLRARVRPLFCALLLSLGRFVRGDGVGGDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVHFIIFVVVQTVLFIGYIMYRSQQEAAAKKFF DIP protein P49257 original sequence version: 110 B87EF117C0CD386C ergic3-marchf2-1 4 10 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined lys8 ubiquitinylated lysine ubiquitinylated lysine certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm 7 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region bira tag bira tag BirA* biotin ligase tag BirA* tag bira biotin ligase tag bira tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Fig. 1A/B ergic3-marchf2-2 5 10 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9Y282:p.[Lys6Arg;Lys8Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R Thu Jan 06 20:04:56 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9Y282:p.[Lys6Arg;Lys8Arg' 7 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 1C, 5B, 5E ergic3-marchf2-3 2 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 7 anti-tag immunocytochemistry anti-tag immunocytochemistry immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9P0N8:p.[Cys64Ser;Cys67Ser] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 2c ergic2-ergic3-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 1A ergic3-ergic3-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 1B ergic3-ergic2-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 1B ergic3-ergic1-1 3 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 1B Weak interaction ergic3-marchf2-4 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A marchf2-ergic3-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9Y282:p.[Lys6Arg;Lys8Arg] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R certain certain sequence position certain certain certain sequence position certain K R 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3B-D serpina1-ergic3-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7A serpina1-lman1-1 3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7A hp-ergic3-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7B serpina1-lman1-2 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 7C hp-ergic3-2 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 7C