IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Accepted 2022-JAN-13 AT 08:19 GMT AT 08:19 GMT by LUANA Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Accepted 2022-JAN-13 AT 08:19 GMT AT 08:19 GMT by LUANA Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Accepted 2022-JAN-13 AT 08:19 GMT AT 08:19 GMT by LUANA Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Binding mode of the side-by-side two-IgV molecule CD226/DNAM-1 to its ligand CD155/Necl-5. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang H., Qi J., Zhang S., Li Y., Tan S., Gao GF. tansg@im.ac.cn, gaof@im.ac.cn Accepted 2022-JAN-13 AT 08:19 GMT AT 08:19 GMT by LUANA Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation cd226_mouse CD226 antigen Cd226 Pta1 Platelet and T-cell activation antigen 1 protein protein mouse Mus musculus Mouse MAYVTWLLAILHVHKALCEETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILPIVGGLVSLLLVILIIIIFILYNRKRRRQVRIPLKEPRDKQSKVATNCRSPTSPIQSTDDEKEDIYVNYPTFSRRPKPRL ACDE524D0F475C97 cd226_human CD226 antigen CD226 DNAM1 DNAX accessory molecule 1 protein protein human Homo sapiens Human MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV 5379182CC4695097 pvr_human Poliovirus receptor PVR PVS Nectin-like protein 5 protein protein human Homo sapiens Human MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLGIGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR DIP protein P15151 original sequence version: 140 D15C012CE853169B cd226-3 3 6 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Table S1 cd226-pvr-1 1 7 unspecified role unspecified role neutral component neutral component purified purified Ig domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 5 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S1 cd226-pvr-2 2 7 unspecified role unspecified role neutral component neutral component purified purified Ig domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 5 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B cd226-pvr-3 2 6 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified Ig domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection direct interaction direct interaction 3A pvr-cd226-1 4 7 unspecified role unspecified role bait bait purified purified Ig domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P15151:p.[Gln63Arg;Phe128Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q R certain certain sequence position certain certain certain sequence position certain F R Thu Jan 06 20:03:19 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln63Arg;Phe128Arg]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3 C/E, 5B cd226-pvr-4 4 7 unspecified role unspecified role bait bait purified purified Ig domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P15151:p.[Gln63Arg;Phe128Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q R certain certain sequence position certain certain certain sequence position certain F R Thu Jan 06 20:21:30 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln63Arg;Phe128Arg]' spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 5 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8K4F0:p.[Gln47Arg;Glu49Arg;His68Ser;Phe114Arg] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain Q R certain certain sequence position certain certain certain sequence position certain E R certain certain sequence position certain certain certain sequence position certain H S Thu Jan 06 20:17:56 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe114Arg;Gln47Arg;Glu49Arg;His68Ser]' Q8K4F0:p.His68Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H A Thu Jan 06 19:31:31 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His68Ala' Q8K4F0:p.Gln47Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q A Thu Jan 06 18:42:50 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln47Ala' Q8K4F0:p.Phe114Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Thu Jan 06 19:35:19 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe114Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 3 D/F, 5A, Supp. figure 4A