MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Disrupted-in-schizophrenia-1 protects synaptic plasticity in a transgenic mouse model of Alzheimer's disease as a mitophagy receptor. Disrupted-in-schizophrenia-1 protects synaptic plasticity in a transgenic mouse model of Alzheimer's disease as a mitophagy receptor. Aging cell 2019 imex curation Wang ZT., Lu MH., Zhang Y., Ji WL., Lei L., Wang W., Fang LP., Wang LW., Yu F., Wang J., Li ZY., Wang JR., Wang TH., Dou F., Wang QW., Wang XL., Li S., Ma QH., Xu RX. Brain Disease - Neurological Diseases & Disorders maquanhong@suda.edu.cn;zjxuruxiang@163.com Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang ZT., Lu MH., Zhang Y., Ji WL., Lei L., Wang W., Fang LP., Wang LW., Yu F., Wang J., Li ZY., Wang JR., Wang TH., Dou F., Wang QW., Wang XL., Li S., Ma QH., Xu RX. Brain Disease - Neurological Diseases & Disorders Male APP/PS1 transgenic mice that co‐express mutant human APP and PS1 (Jackson Laboratory, 004462) maquanhong@suda.edu.cn;zjxuruxiang@163.com Accepted 2021-AUG-09 AT 09:06 BST AT 09:06 BST by MGT Aging cell 2019 Only protein-protein interactions imex curation imex curation no answer from authors for LC3-GFP, I only left the endogenous experiment. disc1_mouse Disrupted in schizophrenia 1 homolog Disc1 protein protein mouse Mus musculus Mouse MQGGGPRGAPIHSPSHGADSGHGLPPAVAPQRRRLTRRPGYMRSTAGSGIGFLSPAVGMPHPSSAGLTGQQSQHSQSKAGQCGLDPGSHCQASLVGKPFLKSSLVPAVASEGHLHPAQRSMRKRPVHFAVHSKNDSRQSERLTGSFKPGDSGFWQELLSSDSFKSLAPSLDAPWNKGSRGLKTVKPLASPALNGPADIASLPGFQDTFTSSFSFIQLSLGAAGERGEAEGCLPSREAEPLHQRPQEMAAEASSSDRPHGDPRHLWTFSLHAAPGLADLAQVTRSSSRQSECGTVSSSSSDTGFSSQDASSAGGRGDQGGGWADAHGWHTLLREWEPMLQDYLLSNRRQLEVTSLILKLQKCQEKVVEDGDYDTAETLRQRLEELEQEKGRLSWALPSQQPALRSFLGYLAAQIQVALHGATQRAGSDDPEAPLEGQLRTTAQDSLPASITRRDWLIREKQRLQKEIEALQARMSALEAKEKRLSQELEEQEVLLRWPGCDLMALVAQMSPGQLQEVSKALGETLTSANQAPFQVEPPETLRSLRERTKSLNLAVRELTAQVCSGEKLCSSLRRRLSDLDTRLPALLEAKMLALSGSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHKTRMKANTVKCMEVLEGQLSSCRCPLLGRVWKADLETCQLLMQSLQLQEAGSSPHAEDEEQVHSTGEAAQTAALAVPRTPHPEEEKSPLQVLQEWDTHSALSPHCAAGPWKEDSHIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALFQSLQGELQTVKETLQAMILQLQPTKEAGEASASYPTAGAQETEA B55A850B15028E6F mlp3a_mouse Microtubule-associated proteins 1A/1B light chain 3A Map1lc3a Autophagy-related protein LC3 A Autophagy-related ubiquitin-like modifier LC3 A MAP1 light chain 3-like protein 1 MAP1A/MAP1B light chain 3 A Microtubule-associated protein 1 light chain 3 alpha protein protein mouse Mus musculus Mouse MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF 48C1FBE8F7892AF3 disc1-map1lc3a-1 1 2 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association fig. 2d disc1-map1lc3a-2 1 2 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association fig. 2d