MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Chromatin-dependent allosteric regulation of DNMT3A activity by MeCP2. Nucleic acids research 2018 imex curation Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro alpha-screen amplified luminescent proximity homogeneous assay AlphaScreen alpha-screen AlphaScreen predetermined predetermined participant predetermined Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A., Rajavelu A., Lungu C., Emperle M., Dukatz M., Bröhm A., Broche J., Hanelt I., Parsa E., Schiffers S., Karnik R., Meissner A., Carell T., Rathert P., Jurkowska RZ., Jeltsch A. Brain Disease - Neurological Diseases & Disorders albert.jeltsch@ibtb.uni-stuttgart.de Accepted 2021-APR-12 AT 12:09 BST AT 12:09 BST by MGT Nucleic acids research 2018 Only protein-protein interactions imex curation imex curation p51608-1 Methyl-CpG-binding protein 2 MECP2 Beta protein protein human Homo sapiens Human MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPRGGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS EB6A33233AEDA566 h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P68431 original sequence version: 78 DIP protein P68431 original sequence version: 79 DIP protein P68431 original sequence version: 76 DIP protein P68431 original sequence version: 92 DIP protein P68431 original sequence version: 87 DIP protein P68431 original sequence version: 101 DIP protein P68431 original sequence version: 130 DIP protein P68431 original sequence version: 115 9B89008EA50A0EF6 mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein Q9Z2D6 original sequence version: 154 62FD228F0118A49F dnm3l_mouse DNA (cytosine-5)-methyltransferase 3-like Dnmt3l protein protein mouse Mus musculus Mouse MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL DIP protein Q9CWR8 original sequence version: 93 DIP protein Q9CWR8 original sequence version: 71 6C996D220C6F6D83 dnm3a_mouse DNA (cytosine-5)-methyltransferase 3A DNA methyltransferase MmuIIIA Cysteine methyltransferase DNMT3A Dnmt3a protein protein mouse Mus musculus Mouse MPSSGPGDTSSSSLEREDDRKEGEEQEENRGKEERQEPSATARKVGRPGRKRKHPPVESSDTPKDPAVTTKSQPMAQDSGPSDLLPNGDLEKRSEPQPEEGSPAAGQKGGAPAEGEGTETPPEASRAVENGCCVTKEGRGASAGEGKEQKQTNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAVMNAVEENQASGESQKVEEASPPAVQQPTDPASPTVATTPEPVGGDAGDKNATKAADDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPACHDSDESDSGKAVEVQNKQMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTTEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFIGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV 5F98D5A8092C84A5 dnmt3a-14 4 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed YFP tag YFP tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1C mecp2-dnmt3a-1 2 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 23 direct interaction direct interaction F1B F2F The interaction between DNMT3A2 and GST-TRD is resistant to high salt washes. They use the human numbering Y526D and D531R, I used the corresponding mouse one. dnmt3a-15 5 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1D mecp2-dnmt3a-3 3 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P51608-1:p.Arg306Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R C Thu Apr 22 11:59:05 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p51608:p.Arg306Cys' ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 34 direct interaction direct interaction F2G SF14 Pull-down experiments in the presence of the non-specific and highly active nuclease from S. marcescens demonstrated that the interaction of both proteins was not mediated by nucleic acids (SupplementaryFigure S14). mecp2-dnmt3a-4 2 7 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 38 41 direct interaction direct interaction F2E mecp2-dnmt3a-5 6 7 unspecified role unspecified role fluorescence donor fluorescence donor purified purified n-terminus GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trd binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined add domain binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 48 45 direct interaction direct interaction SF11 dnmt3a-mecp2-1 1 7 unspecified role unspecified role neutral component neutral component purified purified n-terminus GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range trd binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified mbp tag mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Add binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 52 55 direct interaction direct interaction SF12 mecp2-dnmt3a-6 3 8 competitor competitor competitor neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 63 60 direct interaction direct interaction F6B addition of histone H3 abolished the ADD–TRD interaction, suggesting that H3 and TRD binding to the ADD domain is mutually exclusive. mecp2-dnmt3a-7 3 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 70 67 direct interaction direct interaction F6B addition of histone H3 abolished the ADD–TRD interaction, suggesting that H3 and TRD binding to the ADD domain is mutually exclusive. mecp2-dnmt3a-2 3 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O88508:p.Tyr522Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y E Mon Mar 01 11:42:33 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O88508:p.[Tyr522Glu]' O88508:p.Asp527Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D R Mon Mar 01 11:44:01 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O88508:p.[Glu527Arg]' ecoli Escherichia coli (strain K12) 74 77 direct interaction direct interaction SF13 SF16 The interaction between DNMT3A2 and GST-TRD is resistant to high salt washes. They use the human numbering Y526D and D531R, I used the corresponding mouse one. mecp2-dnmt3a-8 3 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 86 83 direct interaction direct interaction F2A mecp2-dnmt3l-1 3 7 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding range binding range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction F2B