MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. Molecular neurobiology 2019 imex curation Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk Accepted 2021-APR-12 AT 10:49 BST AT 10:49 BST by MGT Molecular neurobiology 2019 Only protein-protein interactions imex curation imex curation The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. Molecular neurobiology 2019 imex curation Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk Accepted 2021-APR-12 AT 10:49 BST AT 10:49 BST by MGT Molecular neurobiology 2019 Only protein-protein interactions imex curation imex curation The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. The Parkinson's Disease-Linked Protein DJ-1 Associates with Cytoplasmic mRNP Granules During Stress and Neurodegeneration. Molecular neurobiology 2019 imex curation Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunostaining immunostaining Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F., Repici M., Hassanjani M., Maddison DC., Garção P., Cimini S., Patel B., Szegö ÉM., Straatman KR., Lilley KS., Borsello T., Outeiro TF., Panman L., Giorgini F. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The interactions in Supplementary Table 1 were not annotated because high-confidence datasets were not available. 12/4/21: this one is "OK to go" but cannot accept as no clickable boxes. (Mgt) dev told. fg36@le.ac.uk Accepted 2021-APR-12 AT 10:49 BST AT 10:49 BST by MGT Molecular neurobiology 2019 Only protein-protein interactions imex curation imex curation if4a3_human Eukaryotic initiation factor 4A-III KIAA0111 EIF4A3 DDX48 Eukaryotic translation initiation factor 4A isoform 3 ATP-dependent RNA helicase eIF4A-3 ATP-dependent RNA helicase DDX48 DEAD box protein 48 Eukaryotic initiation factor 4A-like NUK-34 Nuclear matrix protein 265 protein protein human Homo sapiens Human MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI DIP protein P38919 original sequence version: 160 DIP protein P38919 original sequence version: 161 DIP protein P38919 original sequence version: 124 DIP protein P38919 original sequence version: 137 DIP protein P38919 original sequence version: 157 DIP protein P38919 original sequence version: 146 DIP protein P38919 original sequence version: 151 3A21888CA96CA5EA park7_human Parkinson disease protein 7 PARK7 Oncogene DJ1 Parkinsonism-associated deglycase Maillard deglycase Protein DJ-1 Protein/nucleic acid deglycase DJ-1 protein protein human Homo sapiens Human MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD DIP protein Q99497 original sequence version: 102 4B21661B3A76BC67 tia1_human Nucleolysin TIA-1 isoform p40 TIA1 p40-TIA-1 RNA-binding protein TIA-1 T-cell-restricted intracellular antigen-1 protein protein human Homo sapiens Human MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ 4FD2E8B7AF57A0D6 eif4a3-9 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3A SF1A RNAse park7-tia1-1 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3A SF1B park7-tia1-2 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization F1C F2B park7-tia1-4 3 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization SF5