MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Angiopoietin-1 is required for Schlemm's canal development in mice and humans. Angiopoietin-1 is required for Schlemm's canal development in mice and humans. The Journal of clinical investigation 2017 imex curation Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. comigration in gel comigration in gel electrophoresis comigration in gel weight identificat confirmation by molecular weight weight identificat Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Accepted 2021-MAY-14 AT 16:24 BST AT 16:24 BST by SIMONA The Journal of clinical investigation 2017 imex curation Angiopoietin-1 is required for Schlemm's canal development in mice and humans. Angiopoietin-1 is required for Schlemm's canal development in mice and humans. The Journal of clinical investigation 2017 imex curation Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Accepted 2021-MAY-14 AT 16:24 BST AT 16:24 BST by SIMONA The Journal of clinical investigation 2017 imex curation Angiopoietin-1 is required for Schlemm's canal development in mice and humans. Angiopoietin-1 is required for Schlemm's canal development in mice and humans. The Journal of clinical investigation 2017 imex curation Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Thomson BR., Souma T., Tompson SW., Onay T., Kizhatil K., Siggs OM., Feng L., Whisenhunt KN., Yanovitch TL., Kalaydjieva L., Azmanov DN., Finzi S., Tanna CE., Hewitt AW., Mackey DA., Bradfield YS., Souzeau E., Javadiyan S., Wiggs JL., Pasutto F., Liu X., John SW., Craig JE., Jin J., Young TL., Quaggin SE. Rare diseases - Interactions investigated in the context of Rare genetic disease quaggin@northwestern.edu,tyoung6@wisc.edu Accepted 2021-MAY-14 AT 16:24 BST AT 16:24 BST by SIMONA The Journal of clinical investigation 2017 imex curation tie2_human Angiopoietin-1 receptor TEK TIE2 Tyrosine-protein kinase receptor TIE-2 Tyrosine-protein kinase receptor TEK Tunica interna endothelial cell kinase p140 TEK Endothelial tyrosine kinase Tyrosine kinase with Ig and EGF homology domains-2 VMCM VMCM1 protein protein human Homo sapiens Human MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA DIP protein Q02763 original sequence version: 123 DIP protein Q02763 original sequence version: 79 E739DEC3E4FEB124 angp1_human Angiopoietin-1 ANGPT1 KIAA0003 protein protein human Homo sapiens Human MTVFLSFAFLAAILTHIGCSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF 5D5FA63AEF6BE920 angpt1-1 1 5 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q15389:p.Lys249Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Q15389:p.Gln236_Phe498del Q236* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF . Q15389:p.Arg494_Phe498del R494_F498del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RPLDF . region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q15389:p.Lys249Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R Q15389:p.Gln236_Phe498del Q236* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF . Q15389:p.Arg494_Phe498del R494_F498del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RPLDF . region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6A under nonreducing conditions, WT ANGPT1 protein was predominantly grouped in high-order multimers of greater than 250 kDa, consistent with earlier reports angpt1-angpt1-1 1 5 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered Q15389:p.Arg494_Phe498del R494* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RPLDF . region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed engineered engineered Q15389:p.Arg494_Phe498del R494* mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain RPLDF . region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6E under nonreducing conditions, WT ANGPT1 protein was predominantly grouped in high-order multimers of greater than 250 kDa, consistent with earlier reports tek-angpt1-1 3 4 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range fc tag fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q15389:p.Lys249Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K R flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 6C angpt1-angpt1-2 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q15389:p.Gln236_Phe498del mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain QLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF . HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed engineered engineered flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 6D