UniProt UniProt http://www.uniprot.org Non-homeostatic body weight regulation through a brainstem-restricted receptor for GDF15. Non-homeostatic body weight regulation through a brainstem-restricted receptor for GDF15. Nature 2017 imex curation Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Accepted 2021-OCT-29 AT 09:40 BST AT 09:40 BST by MGT Nature 2017 imex curation Non-homeostatic body weight regulation through a brainstem-restricted receptor for GDF15. Non-homeostatic body weight regulation through a brainstem-restricted receptor for GDF15. Nature 2017 imex curation Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hsu JY., Crawley S., Chen M., Ayupova DA., Lindhout DA., Higbee J., Kutach A., Joo W., Gao Z., Fu D., To C., Mondal K., Li B., Kekatpure A., Wang M., Laird T., Horner G., Chan J., McEntee M., Lopez M., Lakshminarasimhan D., White A., Wang SP., Yao J., Yie J., Matern H., Solloway M., Haldankar R., Parsons T., Tang J., Shen WD., Alice Chen Y., Tian H., Allan BB. ballan@ngmbio.com Accepted 2021-OCT-29 AT 09:40 BST AT 09:40 BST by MGT Nature 2017 imex curation gfral_human GDNF family receptor alpha-like GFRAL C6orf144 UNQ9356/PRO34128 protein protein human Homo sapiens Human MIVFIFLAMGLSLENEYTSQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGEVIYAAMCMTVTCGILLLVMVKLRTSRISSKARDPSSIQIPGEL 641ED7D67CF87428 gdf15_human Growth/differentiation factor 15 GDF15 MIC1 PDF PLAB PTGFB Placental bone morphogenetic protein Placental TGF-beta Macrophage inhibitory cytokine 1 Prostate differentiation factor NSAID-activated gene 1 protein NSAID-regulated gene 1 protein protein protein human Homo sapiens Human MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI 2FF3959021B95238 gfral-gdf15-1 1 3 unspecified role unspecified role bait bait purified purified extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Fig. 1E gfral-gdf15-2 2 3 unspecified role unspecified role neutral component neutral component purified purified extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Extended Data Table 1 gdf15-1 2 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Extended Data Table 1