DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Complete Structure of the Mycobacterium smegmatis 70S Ribosome. The Complete Structure of the Mycobacterium smegmatis 70S Ribosome. Cell reports 2017 imex curation Hentschel J., Burnside C., Mignot I., Leibundgut M., Boehringer D., Ban N. ban@mol.biol.ethz.ch 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Hentschel J., Burnside C., Mignot I., Leibundgut M., Boehringer D., Ban N. ban@mol.biol.ethz.ch Accepted 2021-APR-21 AT 12:42 BST AT 12:42 BST by ORCHARD Cell reports 2017 Only protein-protein interactions imex curation imex curation rs2_mycs2 30S ribosomal protein S2 rpsB MSMEG_2519 MSMEI_2460 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAVVTMKQLLDSGAHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYIDKAYEFVKETVAHGGTVLFVGTKKQAQESIAEEATRVGMPYVNQRWLGGMLTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGGIRDMQKVPSAVWVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDVVDYPIPGNDDAIRSAALLTKVIASAVAEGLQARAGQGSGEKPAEGAEPLAEWEQELLAGATAGAADASAEGAAAPESSTDAS 036147A759DE1B7B rs182_mycs2 30S ribosomal protein S18 2 rpsR2 rpsR1 MSMEG_6895 MSMEI_6711 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKSNKRRPAPEKPVKTRKCVFCSKKGQTIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIAVAVKNAREVALLPFGSSTR 31A5893D10C688D4 rs9_mycs2 30S ribosomal protein S9 rpsI MSMEG_1557 MSMEI_1520 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTDVTETEVVTESAEPREPVIIDRPIQTVGRRKEAVVRVRLVPGTGQFNLDGRTLENYFPNKVHQQLIKAPLVTVDRVDQFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKKAGFLTRDPRAIERKKYGLKKARKAPQYSKR 43D41988EB28EFFD rs16_mycs2 30S ribosomal protein S16 rpsP MSMEG_2435 MSMEI_2374 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAVKIKLTRLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQIDSERAQYWLGVGAQPTEPVLALLKITGDWQKFKGLPGAEGTLKVKEPKPSKLDLFNAALAEAESGTTAAATTPKKKKAPKKDEAAEAPAEAAEAPAEAADAASES FA1C5C9298633F08 rl11_mycs2 50S ribosomal protein L11 rplK MSMEG_1346 MSMEI_1308 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAPKKKVAGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVQKGSGEPHKTKVAKVTWDQVREIAETKKADLNANDIDAAAKIIAGTARSMGITVE 7DE04CBF2F3C37E5 rl2_mycs2 50S ribosomal protein L2 rplB MSMEG_1439 MSMEI_1403 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MGIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITTRHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGEKRYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRKPNKPSDKLIVRRRRTGKKR 1F028C8A34842461 rs20_mycs2 30S ribosomal protein S20 rpsT MSMEG_4571 MSMEI_4459 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MANIKSQIKRIRTNERRRLRNQSVKSSLRTAIRGFREAVDAGDKDKASELLHATSRKLDKAASKGVIHPNQAANKKSALALALNKL 55A530019EF80A90 a0r3d2_mycs2 50S ribosomal protein L25 rplY ctc MSMEG_5431 General stress protein CTC protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKTANIPNKLTANVRTRTGKGASRQARRDGKVPAVLYGHGTDPQHLELNARDFAAVLRSHGTNAILTLDIEGTEQLALTKALDVHPIRRNIQHADLLVVQRGEKVTVEVTVLVEGDATPGTLVTQDANTIEIEAEALSIPEQLTVSVEGVEAGTQITAGQISLPEGVNLISDPELLVVNVVEAPSAEALEEEGAGETGAAEAPAEEAPAEEPAE DB64968DA17CD3E9 rl23_mycs2 50S ribosomal protein L23 rplW MSMEG_1438 MSMEI_1402 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MATITDPRDIILAPVISEKSYGLIEDNVYTFVVHPDSNKTQIKIAIEKIFDVKVDSVNTANRQGKRKRTRTGFGKRKSTKRAIVKLAAGSKPIDLFGAPA interactionMixImport_1518787140337 rl17_mycs2 50S ribosomal protein L17 rplQ MSMEG_1525 MSMEI_1489 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPKPTKGPRLGGSSSHQSALLANLATSLFEHGRIKTTEPKARALRPYAEKLITHAKKGALHNRREVMKKIRDKDVVHTLFAEIGPFYADRNGGYTRIIKVENRKGDNAPMAVIELVREKTVTDEANRARRAAASQAKADERADEKADEKAEETVEETTEAPAEESTEAAAEETVEETTEAPAEESTEAAEESEAKDDTK 7445498731158559 rl3_mycs2 50S ribosomal protein L3 rplC MSMEG_1436 MSMEI_1400 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAVQLAYGEISPRKVIKPVAGQFAAAGVNPRRHVAELRLDDEAAVAEYEVGQELTAEIFSDGAYVDVTGTSKGKGFAGTMKRHGFRGQGAAHGAQAVHRRPGSIGGCATPGRVFKGTRMSGRMGNDRVTTQNLKVHKVDAENGVLLIKGAIPGRNGGLVVVRSAIKRGEK 4FBB59BDAB7CEF24 rl24_mycs2 50S ribosomal protein L24 rplX MSMEG_1466 MSMEI_1430 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MKVHKGDTVLVISGKDKGAKGKVLVAYPDRNKVLVEGVNRIKKHTAVSANERGASSGGIVTQEAPIHVSNVMVVDSDGKPTRVGYRIDDETGKKVRIAKTNGKDI CE6C14C1101A6C0A rl27_mycs2 50S ribosomal protein L27 rpmA MSMEG_4624 MSMEI_4507 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTHFHPGVNVGRGGDDTLFALAPGAVEFGAKRGRKTVNIVPVARPEA 6A0A308894E402CF a0qsg8_mycs2 50S ribosomal protein L15 rplO MSMEG_1474 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSVIKLHDLKPAPGEKKAKTRVGRGEGSKGKTAGRGTKGTKARKNVPVMFEGGQMPIHMRLPKLKGFKNRFRTEYQVVNVGDINKAFPQGGTVGVDELVAKGLVRKNSLVKVLGDGKLTVKVDVTANKFSGSAREAITAAGGSATEL AAA833426126CCFF a0qv03_mycs2 50S ribosomal protein L28 rpmB MSMEG_2400 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAAVCDICGKGPGFGKSVSHSHRRTSRRWNPNIQPVRAVTRPGGNKQRINACTSCIKAGKVSRA 36AF19D5AC7BAFAF rl13_mycs2 50S ribosomal protein L13 rplM MSMEG_1556 MSMEI_1519 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPTYTPKAGDTTRSWYVIDASDVVLGRLASAAATLLRGKHKPTFTPNVDGGDFVIVINADKIAVSGDKLTKKFAYRHSGYPGGLRKRTIGELLEKHPTRVVENAIIGMLPHNKLGRQIQKKLKVYAGPDHPHAAQQPIPFEIKQVAQ BBE4AC000F9925B4 rl21_mycs2 50S ribosomal protein L21 rplU MSMEG_4625 MSMEI_4508 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MATYAIVKTGGKQYKVAAGDVVKVEKLDSEPGASVSLPVALVVDGANVTSKADDLAKVAVTAEVLEHTKGPKIRIHKFKNKTGYHKRQGHRQQLTVLKVTGIK 79524E8A2DF81DDC rs4_mycs2 30S ribosomal protein S4 rpsD MSMEG_1523 MSMEI_1487 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MARYTGPATRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRQQLQEKQKARFSYGVMEKQFRRYYEEANRQPGKTGDNLLRILESRLDNVVYRAGLARTRRMARQLVSHGHFLVNGVKVDIPSYRVSQYDIIDVKEKSLNTLPFQIARETAGERPIPSWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYSK F6AC4F66558E0968 rs14z_mycs2 30S ribosomal protein S14 type Z rpsZ rpsN MSMEG_1468 MSMEI_1432 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKKALVHKANKKPKFAVRAYTRCNKCGRPHSVYRKFGLCRICLREMAHAGELPGVQKSSW E5AF676E4DCF16A1 rs3_mycs2 30S ribosomal protein S3 rpsC MSMEG_1442 MSMEI_1406 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MGQKINPHGFRLGITTEWKSRWYADKQYKDYVKEDVAIRKLLATGLERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPASDRPRRERPSGTRPRRSGSAGTTATSTEAGRAATSDAPAAGTAAAAEAPAESTES A76FA94ECBB443BE rl32_mycs2 50S ribosomal protein L32 rpmF MSMEG_5489 MSMEI_5337 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAVPKRRMSRANTRSRRAQWKAEAPGLVTVSVAGQQRKVPRRLLKAARLGLVDLDKR A1A35828ABBB383B a0qsg5_mycs2 50S ribosomal protein L18 rplR MSMEG_1471 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAHKPVGQNISEVRRNARLRRHARLRKKVAGTAEVPRLVVNRSARHIHVQLVNDLNGTTLAAASSIEADVRAIDGDKKAHSVRVGQLIAERAKAAGVETVVFDRGGYTYGGRIAALADAAREAGLKF 48BD2D7C3BABEBE9 rl6_mycs2 50S ribosomal protein L6 rplF MSMEG_1470 MSMEI_1434 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSRIGKQPVPVPSGVDVTINGQNLSVKGPKGTLTLDVAEPISVSRAEDGAIVVTRPDDERRSRSLHGLSRTLIANLVTGVTEGYTQKMEIFGVGYRVQLKGQNLEFALGYSHPVLIEAPEGITFAVESPTKFSVSGIDKQKVGQISAVIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK 1668D25BBD493EA5 rl4_mycs2 50S ribosomal protein L4 rplD MSMEG_1437 MSMEI_1401 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTLKVDVKTPAGKTDGSVELPAELFDVEPNIALMHQVVTAQLAAKRQGTHSTKTRGEVSGGGKKPYRQKGTGRARQGSTRAPQFTGGGTVHGPKPRDYSQRTPKKMIAAALRGALSDRARNDRIHAVTELVEGQTPSTKSAKTFLGTLTENKKVLVVIGRTDEVGAKSVRNLPGVHVISPDQLNTYDVLNADDVVFSVEALNAYISANSKEGASV CC681F99FC2C5F56 rl22_mycs2 50S ribosomal protein L22 rplV MSMEG_1441 MSMEI_1405 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSTVTEFPSATAKARYVRVSATKARRVIDLVRGKSVEEALDILRWAPQAASEPVAKVIASAAANAQNNEGLDPSTLVVATVYADEGPTAKRIRPRAQGRAFRIRKRTSHITVIVESRPPKQKGASAASARSRRAQGSKAAATKKSAETKEGSE 67F139A4E851F1C6 rs19_mycs2 30S ribosomal protein S19 rpsS MSMEG_1440 MSMEI_1404 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKSKRR 272D7E4C448AF76E rl9_mycs2 50S ribosomal protein L9 rplI MSMEG_6894 MSMEI_6710 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MKLILTAEVEHLGAAGDTVEVKDGYGRNYLLPRGLAIVASRGAERQAEEIRRARESKVIRDIEHANELKTALEGLGDVTLSVNAAGDTGKLFGSVTAADVVNAIKKAGGPNLDKRTVQLAKAHIKSVGTHPVTVKLHTGVEAKVSLNVVAQ CA4F4ABB3E45F66B rs8_mycs2 30S ribosomal protein S8 rpsH MSMEG_1469 MSMEI_1433 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYRTEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLGVAIISTSSGLLTDRQAARQGVGGEVLAYVW 465820E7F60B0E8D a0qtp4_mycs2 MSMEG_1916 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKRGRKKRDRKHSKANHGKRPNA 09E4A44E672F429E rs10_mycs2 30S ribosomal protein S10 rpsJ MSMEG_1435 MSMEI_1399 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYCVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ 76FF1CDC3DDE0DF6 rl34_mycs2 50S ribosomal protein L34 rpmH MSMEG_6946 MSMEI_6752 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVANRRSKGRRALTA FAADBE30CB5B96ED rl31_mycs2 50S ribosomal protein L31 rpmE MSMEG_4951 MSMEI_4823 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MKTGIHPEYVDTTVQCGCGHSFTTRSTKQSGTIVVEVCSQCHPFYTGKQKILDSGGRVARFEKRYGKRNKAAADK D05971676DE383D0 rl14_mycs2 50S ribosomal protein L14 rplN MSMEG_1465 MSMEI_1429 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGGNVKRGDVVKAVVVRTVKERRRADGSYIKFDENAAVIIKNDNDPRGTRIFGPVGRELREKKFMKIVSLAPEVL A6530E503D933A1F rs7_mycs2 30S ribosomal protein S7 rpsG MSMEG_1399 MSMEI_1361 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQAREKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVNFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW 394E242E87B61AF0 rl30_mycs2 50S ribosomal protein L30 rpmD MSMEG_1473 MSMEI_1437 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAELKITQVRSTIGARWKQRESLRTLGLKKIRQSVVREDNAQTRGLINTVHHLVEVEEVGK F5183BB0C2DD02EA rs17_mycs2 30S ribosomal protein S17 rpsQ MSMEG_1445 MSMEI_1409 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MADQKGPKYTPAAEKPRGRRKTAIGYVVSDKMQKTIVVELEDRKSHPLYGKIIRTTKKVKAHDENGEAGIGDRVSLMETRPLSATKRWRLVEILEKAK 6BC9DDA0ECE4C36F rs15_mycs2 30S ribosomal protein S15 rpsO MSMEG_2654 MSMEI_2591 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHHSRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR A5711F279E833190 rs5_mycs2 30S ribosomal protein S5 rpsE MSMEG_1472 MSMEI_1436 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAEQAGAGSAQDNRGGRGRRDDRGGRGRDGGDKSNYIERVVSINRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEEARKNFFRVPLIGSTITHPVQGEAAAGVVMLRPASPGTGVIAGGAARAVLECAGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRESEALAAAAAREGSA 776D6119907F713C rl35_mycs2 50S ribosomal protein L35 rpmI MSMEG_3792 MSMEI_3704 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPTKRTRRLDGRTTVSAADNSRINKLLNG 5ADA5D425240E93B rl10_mycs2 50S ribosomal protein L10 rplJ MSMEG_1364 MSMEI_1325 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSATYTVAKNTLVKRAASEAGIEGLDELFAGPTAIAFVKGEAVDAAKAIKKFAKDNKALVIKGGYMDGKALSVADVEKIADLESREVLLAKLAGAMKGNLSKAAGLFNAPASQVARLAAALQEKKAGEEAA 49BE7312E43CC5F2 rl20_mycs2 50S ribosomal protein L20 rplT MSMEG_3791 MSMEI_3703 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MARVKRALNAQKKRRTVLKASKGYRGQRSRLYRKAKEQQLHSLTYAYRDRRARKGEFRKLWISRINAAARANDITYNRLIQGLKAAGVEVDRKNLAELAVSDPAAFTALVDVARAALPEDVNAPSGEAA 20CC470CE46DE29F rs6_mycs2 30S ribosomal protein S6 rpsF MSMEG_6897 MSMEI_6713 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIYAVIDVKAEPATVSELDRQLNLNESVLRTKVLRTDKH 28C958C9E701B3F2 rl331_mycs2 50S ribosomal protein L33 1 rpmG1 rpmG2 MSMEG_1339 MSMEI_1301 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGTHQPHKESR 7A1D1286013FB0B6 a0qr10_mycs2 MSMEG_0945 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MGSVIKKRRKRMSKKKHRKLLRRTRVQRRKLGK 8156A587F16291F5 rs11_mycs2 30S ribosomal protein S11 rpsK MSMEG_1522 MSMEI_1486 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAQAKKGGTAAKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGRETAIRSLQAAGLEVGTISDVTPQPHNGCRPPKRRRV D45561FBC1325FA2 rl5_mycs2 50S ribosomal protein L5 rplE MSMEG_1467 MSMEI_1431 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTTTEKALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAKLINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWEFLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDRPRGMDITVVTTATNDAEGRALLRALGFPFKEN E7F306D071E5C282 rs13_mycs2 30S ribosomal protein S13 rpsM MSMEG_1521 MSMEI_1485 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MARLVGVDLPRDKRMEIALTYIYGIGRTRSNEILAATGIDKNMRTKDLTDDQVTVLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPKRTIAGKKKAR B6A3ECB1466A82FD rs12_mycs2 30S ribosomal protein S12 rpsL MSMEG_1398 MSMEI_1360 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPTIQQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKS 669BE4F3AD829616 rl29_mycs2 50S ribosomal protein L29 rpmC MSMEG_1444 MSMEI_1408 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAVGTTPGELRELTDDELKDKLRESKEELFNLRFQMATGQLSNNRRLRTVRQEIARVYTVLRERELGLASGPAGEES EB7CD1454BB47947 rl16_mycs2 50S ribosomal protein L16 rplP MSMEG_1443 MSMEI_1407 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MLIPRKVKHRKQHHPEQRGIASGGTSVSFGDYGIQALEHAYITNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPDEKTARDALTRAIHKLPIKARIVTREEQF 4ADDA3E2DFACA67E rl36_mycs2 50S ribosomal protein L36 rpmJ MSMEG_1520 MSMEI_1484 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG C92A4845314F496F rl19_mycs2 50S ribosomal protein L19 rplS MSMEG_2440 MSMEI_2379 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MNTLDFVDQASLRDDIPTFSPGDTVNVHVKVIEGSKERIQVFKGVVIRRQGGGISETFTVRKESYGVGVERTFPVHSPNIDHIDVLTRGDVRRAKLYYLRELRGKKAKIKEKR 790B33A229D8CFCF a0qr10_mycs2-a0qtp4_mycs2-2 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 27 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 37 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 38 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 20 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 48 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 49 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 46 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 31 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 29 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 35 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 43 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 39 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 19 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 21 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 45 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 33 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 52 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 40 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 32 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 44 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 22 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 36 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 50 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 16 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 10 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 26 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 42 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 53 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 23 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 51 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 34 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 17 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 41 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 28 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 24 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 47 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 25 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 30 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1, Fig S1, Table S1 a0qtp4_mycs2-rplb-2 1 13 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 10 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 26 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 18 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 42 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 53 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 23 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 11 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 51 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 15 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 34 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 17 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 41 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 28 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 24 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 47 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 25 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 30 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 33 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 40 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 32 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 44 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 22 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 36 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 50 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 16 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 22 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1, Fig S1, Table S1 a0qr10_mycs2-rpme-1 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 27 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 37 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 38 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 20 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 48 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 49 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 29 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 35 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 43 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 39 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 19 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 21 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 45 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 33 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 46 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1, Fig S1, Table S1