UniProt UniProt http://www.uniprot.org A Glutaredoxin·BolA Complex Serves as an Iron-Sulfur Cluster Chaperone for the Cytosolic Cluster Assembly Machinery. A Glutaredoxin·BolA Complex Serves as an Iron-Sulfur Cluster Chaperone for the Cytosolic Cluster Assembly Machinery. The Journal of biological chemistry 2016 imex curation Frey AG., Palenchar DJ., Wildemann JD., Philpott CC., Frey AG., Palenchar DJ., Wildemann JD., Philpott CC. cannot get this pmid into Imex Central - Lukasz informed 20/7/21 (mgt) Carolinep@mail.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Frey AG., Palenchar DJ., Wildemann JD., Philpott CC., Frey AG., Palenchar DJ., Wildemann JD., Philpott CC. cannot get this pmid into Imex Central - Lukasz informed 20/7/21 (mgt) Source of Glrx3 inferred by mutant mapping Carolinep@mail.nih.gov Accepted 2021-JUL-20 AT 10:40 BST AT 10:40 BST by MGT The Journal of biological chemistry 2016 imex curation A Glutaredoxin·BolA Complex Serves as an Iron-Sulfur Cluster Chaperone for the Cytosolic Cluster Assembly Machinery. A Glutaredoxin·BolA Complex Serves as an Iron-Sulfur Cluster Chaperone for the Cytosolic Cluster Assembly Machinery. The Journal of biological chemistry 2016 imex curation Frey AG., Palenchar DJ., Wildemann JD., Philpott CC., Frey AG., Palenchar DJ., Wildemann JD., Philpott CC. cannot get this pmid into Imex Central - Lukasz informed 20/7/21 (mgt) Carolinep@mail.nih.gov Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down weight identificat confirmation by molecular weight weight identificat Frey AG., Palenchar DJ., Wildemann JD., Philpott CC., Frey AG., Palenchar DJ., Wildemann JD., Philpott CC. cannot get this pmid into Imex Central - Lukasz informed 20/7/21 (mgt) Source of Glrx3 inferred by mutant mapping Carolinep@mail.nih.gov Accepted 2021-JUL-20 AT 10:40 BST AT 10:40 BST by MGT The Journal of biological chemistry 2016 imex curation glrx3_human Glutaredoxin-3 GLRX3 Thioredoxin-like protein 2 PKC-interacting cousin of thioredoxin PKC-theta-interacting protein PICOT HUSSY-22 TXNL2 protein protein human Homo sapiens Human MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN DIP protein O76003 original sequence version: 156 46D644413D9EDFDA bola2_human BolA-like protein 2 BOLA2 BOLA2B BOLA2A My016 protein protein human Homo sapiens Human MELSAEYLREKLQRDLEAEHVEVEDTTLNRCSCSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAFEQKTLTPDQWARERQK CA95C76A225B5384 ciao1_human Probable cytosolic iron-sulfur protein assembly protein CIAO1 WD repeat-containing protein 39 CIAO1 WDR39 CIA1 protein protein human Homo sapiens Human MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL 63A8D8257A204FC8 cpin1_human Anamorsin Cytokine-induced apoptosis inhibitor 1 CIAPIN1 PRO0915 CUA001 Fe-S cluster assembly protein DRE2 homolog protein protein human Homo sapiens Human MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA 70A71D44074ABFBA ndor1_human NADPH-dependent diflavin oxidoreductase 1 NDOR1 NADPH-dependent FMN and FAD-containing oxidoreductase NR1 Novel reductase 1 protein protein human Homo sapiens Human MPSPQLLVLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINEPLVIFVCATTGQGDPPDNMKNFWRFIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPVCLGDDQHELGPDAAVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAPSTGSEGQRVAHPGSQEPPSESKPFLAPMISNQRVTGPSHFQDVRLIEFDILGSGISFAAGDVVLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVSHYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA 0D1340D7280A4D8F bola2-glrx3-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 1A, 1B, 1C, 1E, 3A, 3C, 6B Fe3+ (CHEBI:29034) Desferrioxamine B (CHEBI:4356) Reduced interaction was observed in NFS1 (Q9Y697) depleted cells, the interaction was not restored by treating the cells with iron. glrx3-bola2-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 1A, 3E Fe3+ (CHEBI:29034) glrx3-bola2-2 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain O76003:p.[Cys159Ser;Trp197_Pro198delinsAspAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA Tue Oct 05 18:29:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O76003:p.[Cys159Ser;Trp197Asp;Pro198Ala]' O76003:p.[Cys261Ser;Trp299_Pro300delinsAspAla] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA Tue Oct 05 19:22:24 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O76003:p.[Cys261Ser;Trp299Asp;Pro300Ala]' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal bira biotin ligase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O76003:p.[Cys159Ser;Trp197_Pro198delinsAspAla;Cys261Ser;Trp299_Pro300delinsAspAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA Tue Oct 05 19:18:29 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O76003:p.[Cys159Ser;Trp197Asp;Pro198Ala;Cys261Ser;Trp299Asp;Pro300Ala]' 4 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2C glrx3-glrx3-1 2 3 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate O76003:p.[Cys159Ser;Trp197_Pro198delinsAspAla;Cys261Ser;Trp299_Pro300delinsAspAla] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA certain certain sequence position certain certain certain sequence position certain WP DA Tue Oct 05 18:52:13 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O76003:p.[Cys159Ser;Trp197Asp;Pro198Ala;Cys261Ser;Trp299Asp;Pro300Ala]' n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal bira biotin ligase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3 weight identificat confirmation by molecular weight weight identificat western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4A-C, 5 Interaction was reduced when levels of BolA2 were depleted. Iron did not promote Glrx3 homodimerization. glrx3-ciao1-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 6A glrx3-ciapin1-6 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 7A bola2-ciapin1-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 7A weak interaction ciapin1-bola2-1 1 3 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Figs. 7B, 7C ciapin1-glrx3-17 1 3 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 7C Interaction observed in cells depleted of BOLA2 glrx3-ciapin1-7 1 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal bira biotin ligase tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O76003:p.[Cys159Ser;Trp197_Pro198delinsAspAla;Cys261Ser;Trp299_Pro300delinsAspAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain WP DA Tue Oct 05 18:46:43 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'O76003:p.[Cys159Ser;Trp197Asp;Pro198Ala;Cys261Ser;Trp299Asp;Pro300Ala]' 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 7D bola2-ndor1-1 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 7E glrx3-ndor1-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 7E ciapin1-ndor1-11 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate C-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 7E, 7F Interaction was observed when cells were depleted of either GLRX3 or BOLA2