UniProt UniProt http://www.uniprot.org Diverse oligomeric states of CEACAM IgV domains. Diverse oligomeric states of CEACAM IgV domains. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu Accepted 2021-FEB-08 AT 16:39 GMT AT 16:39 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Diverse oligomeric states of CEACAM IgV domains. Diverse oligomeric states of CEACAM IgV domains. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu Accepted 2021-FEB-08 AT 16:39 GMT AT 16:39 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Diverse oligomeric states of CEACAM IgV domains. Diverse oligomeric states of CEACAM IgV domains. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu Accepted 2021-FEB-08 AT 16:39 GMT AT 16:39 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Diverse oligomeric states of CEACAM IgV domains. Diverse oligomeric states of CEACAM IgV domains. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bonsor DA., Günther S., Beadenkopf R., Beckett D., Sundberg EJ. esundberg@ihv.umaryland.edu Accepted 2021-FEB-08 AT 16:39 GMT AT 16:39 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation ceam6_human Carcinoembryonic antigen-related cell adhesion molecule 6 CEACAM6 NCA Non-specific crossreacting antigen Normal cross-reacting antigen protein protein human Homo sapiens Human MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI 28469487A74C18A4 ceam5_human Carcinoembryonic antigen-related cell adhesion molecule 5 CEACAM5 CEA Carcinoembryonic antigen Meconium antigen 100 protein protein human Homo sapiens Human MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI DIP protein P06731 original sequence version: 110 86318E244155DB58 ceam8_human Carcinoembryonic antigen-related cell adhesion molecule 8 CEACAM8 CGM6 CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 protein protein human Homo sapiens Human MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI AACF74DA1AC839D8 ceam1_human Carcinoembryonic antigen-related cell adhesion molecule 1 CEACAM1 BGP BGP1 Biliary glycoprotein 1 protein protein human Homo sapiens Human MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ DIP protein P13688 original sequence version: 164 CAD1B2328D069AF8 ceacam6-1 1 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Supp Table 1. ceacam6-ceacam8-1 4 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Table 1. ceacam8-1 2 7 unspecified role unspecified role neutral component neutral component purified purified P31997:p.Gln123Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q A P31997:p.Leu129Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P31997:p.Arg77Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2D, S2, Supp Table 3. Kdimerization=6.5x10-4M ceacam6-6 2 5 unspecified role unspecified role neutral component neutral component purified purified P40199:p.Ile63Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Mon Mar 01 11:36:05 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:pIle63Ala' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P40199:p.Leu78Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Mon Mar 01 10:45:01 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Leu78Ala' P40199:p.Gln123Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q A Mon Mar 01 11:22:03 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Gln123Ala' P40199:p.Leu129Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Mon Mar 01 11:04:36 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Leu129Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A, S2, Supp Table 3. Kdimerization=6.0x10-5M ceacam5-1 2 6 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2B Kdimerization=1.5x10-6M ceacam1-1 2 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2B Kdimerization=4.5x10-4M ceacam6-ceacam8-2 3 5 unspecified role unspecified role neutral component neutral component purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined observed-ptm observed-ptm observed ptm observed-ptm human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 7 unspecified role unspecified role neutral component neutral component purified purified region glycores glycosylated residue GlycoRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction Fig. 4B ceacam6-ceacam8-3 3 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P31997:p.Arg77Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A P31997:p.Gln123Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q A P31997:p.Leu129Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4A, SUpp. Fig.4, Supp Table 3 ceacam6-ceacam8-4 3 5 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P40199:p.Ile63Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Mon Mar 01 11:11:33 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:pIle63Ala' P40199:p.Leu78Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Mon Mar 01 11:31:38 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Leu78Ala' P40199:p.Gln123Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q A Mon Mar 01 10:59:03 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Gln123Ala' P40199:p.Leu129Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Mon Mar 01 10:53:11 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P31997:p.Leu129Ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4A, Supp. Fig.4, Supp Table 3