UniProt UniProt http://www.uniprot.org The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. Nucleic acids research 2014 imex curation Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Accepted 2022-JAN-28 AT 10:02 GMT AT 10:02 GMT by MGT Nucleic acids research 2014 Only protein-protein interactions imex curation imex curation The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. Nucleic acids research 2014 imex curation Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Accepted 2022-JAN-28 AT 10:02 GMT AT 10:02 GMT by MGT Nucleic acids research 2014 Only protein-protein interactions imex curation imex curation The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. Nucleic acids research 2014 imex curation Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Accepted 2022-JAN-28 AT 10:02 GMT AT 10:02 GMT by MGT Nucleic acids research 2014 Only protein-protein interactions imex curation imex curation The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. The activation of the decapping enzyme DCP2 by DCP1 occurs on the EDC4 scaffold and involves a conserved loop in DCP1. Nucleic acids research 2014 imex curation Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down western blot western blot Immuno blot Immuno blot Chang CT., Bercovich N., Loh B., Jonas S., Izaurralde E. lisa.izaurralde@tuebingen.mpg.de Accepted 2022-JAN-28 AT 10:02 GMT AT 10:02 GMT by MGT Nucleic acids research 2014 Only protein-protein interactions imex curation imex curation xrn1_human 5'-3' exoribonuclease 1 Strand-exchange protein 1 homolog XRN1 SEP1 protein protein human Homo sapiens Human MGVPKFYRWISERYPCLSEVVKEHQIPEFDNLYLDMNGIIHQCSHPNDDDVHFRISDDKIFTDIFHYLEVLFRIIKPRKVFFMAVDGVAPRAKMNQQRGRRFRSAKEAEDKIKKAIEKGETLPTEARFDSNCITPGTEFMARLHEHLKYFVNMKISTDKSWQGVTIYFSGHETPGEGEHKIMEFIRSEKAKPDHDPNTRHCLYGLDADLIMLGLTSHEAHFSLLREEVRFGGKKTQRVCAPEETTFHLLHLSLMREYIDYEFSVLKEKITFKYDIERIIDDWILMGFLVGNDFIPHLPHLHINHDALPLLYGTYVTILPELGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYVQAIQWILHYYYHGVQSWSWYYPYHYAPFLSDIHNISTLKIHFELGKPFKPFEQLLAVLPAASKNLLPACYQHLMTNEDSPIIEYYPPDFKTDLNGKQQEWEAVVLIPFIDEKRLLEAMETCNHSLKKEERKRNQHSECLMCWYDRDTEFIYPSPWPEKFPAIERCCTRYKIISLDAWRVDINKNKITRIDQKALYFCGFPTLKHIRHKFFLKKSGVQVFQQSSRGENMMLEILVDAESDELTVENVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRKGIIINETSAVVYAQLLTGRKYQINQNGEVRLEKQWSKQVVPFVYQTIVKDIRAFDSRFSNIKTLDDLFPLRSMVFMLGTPYYGCTGEVQDSGDVITEGRIRVIFSIPCEPNLDALIQNQHKYSIKYNPGYVLASRLGVSGYLVSRFTGSIFIGRGSRRNPHGDHKANVGLNLKFNKKNEEVPGYTKKVGSEWMYSSAAEQLLAEYLERAPELFSYIAKNSQEDVFYEDDIWPGENENGAEKVQEIITWLKGHPVSTLSRSSCDLQILDAAIVEKIEEEVEKCKQRKNNKKVRVTVKPHLLYRPLEQQHGVIPDRDAEFCLFDRVVNVRENFSVPVGLRGTIIGIKGANREADVLFEVLFDEEFPGGLTIRCSPGRGYRLPTSALVNLSHGSRSETGNQKLTAIVKPQPAVHQHSSSSSVSSGHLGALNHSPQSLFVPTQVPTKDDDEFCNIWQSLQGSGKMQYFQPTIQEKGAVLPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKMSNKQPNSGIENFLASLNISKENEVQSSHHGEPPSEEHLSPQSFAMGTRMLKEILKIDGSNTVDHKNEIKQIANEIPVSSNRRDEYGLPSQPKQNKKLASYMNKPHSANEYHNVQSMDNMCWPAPSQIPPVSTPVTELSRICSLVGMPQPDFSFLRMPQTMTVCQVKLSNGLLVHGPQCHSENEAKEKAALFALQQLGSLGMNFPLPSQVFANYPSAVPPGTIPPAFPPPTGWDHYGSNYALGAANIMPSSSHLFGSMPWGPSVPVPGKPFHHTLYSGTMPMAGGIPGGVHNQFIPLQVTKKRVANKKNFENKEAQSSQATPVQTSQPDSSNIVKVSPRESSSASLKSSPIAQPASSFQVETASQGHSISHHKSTPISSSRRKSRKLAVNFGVSKPSE DIP protein Q8IZH2 original sequence version: 85 D06A76208DE78698 edc4_human Enhancer of mRNA-decapping protein 4 Human enhancer of decapping large subunit Autoantigen Ge-1 Autoantigen RCD-8 EDC4 HEDLS protein protein human Homo sapiens Human MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCLSEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQDPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEYLILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTAHEDFTFGESRPELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMTPSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPPEELTLSPKLQLDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTATSALSLELQEVEPLGLPQASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASAASALHLLSPRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDSFRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP DIP protein Q6P2E9 original sequence version: 74 DIP protein Q6P2E9 original sequence version: 96 0790BB8ADF488356 pnrc2_human Proline-rich nuclear receptor coactivator 2 PNRC2 HSPC208 protein protein human Homo sapiens Human MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV 072039CB52551F90 dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL DIP protein Q9NPI6 original sequence version: 76 DIP protein Q9NPI6 original sequence version: 96 DIP protein Q9NPI6 original sequence version: 120 26480D0B10CE7C72 dcp2_human m7GpppN-mRNA hydrolase Nucleoside diphosphate-linked moiety X motif 20 DCP2 NUDT20 mRNA-decapping enzyme 2 protein protein human Homo sapiens Human METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL DIP protein Q8IU60 original sequence version: 72 DIP protein Q8IU60 original sequence version: 94 DIP protein Q8IU60 original sequence version: 95 C0FA503A0C797967 dcp2-edc4-1 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8IU60:p.Glu148Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E Q Q8IU60:p.Trp44Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Q8IU60:p.Lys130Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Q8IU60:p.Gly96_Val97delinsProPro mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain GV PP Fri Jan 28 17:30:38 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8IU60:p.[Gly96Pro;Val97Pro]' 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 1B, 6F dcp2-edc4-3 2 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q8IU60:p.[Phe404Ala;Phe407Ala;Phe409Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1D dcp2-edc4-2 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 2A, 3B edc4-dcp2-2 1 9 unspecified role unspecified role bait bait cell lysate cell lysate purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2B xrn1-edc4-1 1 5 unspecified role unspecified role bait bait cell lysate cell lysate purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2C xrn1-dcp2-1 1 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait cell lysate cell lysate purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) association association Fig. 2C xrn1-edc4-2 3 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3A edc4-edc4-1 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3C dcp1a-edc4-2 3 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPI6:p.Arg72Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R G Q9NPI6:p.Asn74Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N G Q9NPI6:p.Arg72_Met75delinsGlySerSerGly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain RLNM GSSG Fri Jan 28 18:33:22 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Arg72Gly;Leu73Ser;Asn74Ser;Met75Gly' Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S Q9NPI6:p.His19Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H A Q9NPI6:p.Gln18_His19delinsAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain QH AA Fri Jan 28 18:03:25 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Gln18Ala;His19Ala]' Q9NPI6:p.[Ser12Ala;Gln18_His19delinsAlaAla] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain QH AA certain certain sequence position certain certain certain sequence position certain S A Fri Jan 28 18:09:13 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Ser12Ala;Gln18Ala;His19Ala]' Q9NPI6:p.[Ser12Ala;His19Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain S A 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3D, 5B, 7B dcp2-dcp1a-6 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q8IU60:p.[Phe404Ala;Phe407Ala;Phe409Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A Q8IU60:p.[Asp15Ala;Arg19Ala;Phe404Ala;Phe407Ala;Phe409Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A dcp2-dcp1a-7 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait cell lysate cell lysate purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8IU60:p.[Asp15Ala;Arg19Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain R A Fri Jan 28 17:42:42 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.Q8IU60:p.[Asp15Ala;Arg19Ala]' ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate nusA tag region fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) association association Fig. 5C dcp2-dcp1a-8 3 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8IU60:p.Glu148Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E Q Q8IU60:p.Trp44Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain W A Q8IU60:p.Lys130Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Q8IU60:p.Gly96_Val97delinsProPro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain GV PP Fri Jan 28 18:35:48 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q8IU60:p.[Gly96Pro;Val97Pro]' 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 6G dcp1a-dcp2-3 3 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain L S Q9NPI6:p.Arg72Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R G Q9NPI6:p.Asn74Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N G Q9NPI6:p.Arg72_Met75delinsGlySerSerGly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain RLNM GSSG Fri Jan 28 17:34:08 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Arg72Gly;Leu73Ser;Asn74Ser;Met75Gly]' 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7A dcp2-dcp1a-9 4 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sbp sbp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPI6:p.[Leu4Glu;Ala14Gln] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L E certain certain sequence position certain certain certain sequence position certain A Q physical association physical association Supp Fig. 1E A Pro78Lys substitution in DCP2 and a Leu4Glu,Ala14Gln substitution in DCP1 increased the affinity of the DCP1–DCP2 interaction but only when they were combined by mutations that disrupt EDC4 binding (DCP2 Phe404Ala,Phe407Ala,Phe409Ala) dcp1a-pnrc2-8 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate Q9NPI6:p.Arg72_Met75delinsGlySerSerGly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain RLNM GSSG Fri Jan 28 18:15:06 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Arg72Gly;Leu73Ser;Asn74Ser;Met75Gly]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPI6:p.[Ser12Ala;Gln18_His19delinsAlaAla] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain QH AA Fri Jan 28 17:50:16 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Ser12Ala;Gln18Ala;His19Ala]' Q9NPI6:p.[Arg72Gly;Asn74Gly] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R G certain certain sequence position certain certain certain sequence position certain N G physical association physical association Supplementary Fig. 2D dcp2-dcp1a-10 3 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NPI6:p.Gln18_His19delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain QH AA Fri Jan 28 17:48:47 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Gln18Ala;His19Ala]' Q9NPI6:p.His19Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H A Q9NPI6:p.[Ser12Ala;Gln18_His19delinsAlaAla] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain QH AA certain certain sequence position certain certain certain sequence position certain S A Fri Jan 28 17:51:23 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Ser12Ala;Gln18Ala;His19Ala]' Q9NPI6:p.[Ser12Ala;His19Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain S A Fri Jan 28 17:48:12 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9NPI6:p.[Ser12Ala;His19Ala]' Q9NPI6:p.[Leu554Ser;Phe561Arg;Leu565Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L S certain certain sequence position certain certain certain sequence position certain F R certain certain sequence position certain certain certain sequence position certain L S physical association physical association Fig. 5A