IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. The Journal of cell biology 2012 imex curation Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Accepted 2021-SEP-29 AT 11:28 BST AT 11:28 BST by ORCHARD The Journal of cell biology 2012 imex curation Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. The Journal of cell biology 2012 imex curation Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Accepted 2021-SEP-29 AT 11:28 BST AT 11:28 BST by ORCHARD The Journal of cell biology 2012 imex curation Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. Crystal structure of α5β1 integrin ectodomain: atomic details of the fibronectin receptor. The Journal of cell biology 2012 imex curation Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nagae M., Re S., Mihara E., Nogi T., Sugita Y., Takagi J. takagi@protein.osaka-u.ac.jp Accepted 2021-SEP-29 AT 11:28 BST AT 11:28 BST by ORCHARD The Journal of cell biology 2012 imex curation antibody hc Antibody hc protein protein mouse Mus musculus Mouse QVHLQQSGAELMKPGASVKISCKATGYTFTSYWIEWVKQRPGHGLEWLGEILPGSGYIHYNEKFKGKATFTTDTSSNTAYMQLSSLTSEDSAVYYCSRALALYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR itb1_human Integrin beta-1 Fibronectin receptor subunit beta VLA-4 subunit beta ITGB1 FNRB MDF2 MSK12 Glycoprotein IIa protein protein human Homo sapiens Human MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK DIP protein P05556 original sequence version: 139 DIP protein P05556-1 original sequence version: 143 DIP protein P05556 original sequence version: 154 DIP protein P05556 original sequence version: 167 DE35979C1625578C ita5_human Integrin alpha-5 ITGA5 FNRA Fibronectin receptor subunit alpha Integrin alpha-F VLA-5 CD49 antigen-like family member E protein protein human Homo sapiens Human MGSRTPESPLHAVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA DIP protein P08648 original sequence version: 123 DIP protein P08648 original sequence version: 137 6B4D558D4F739CBA antibody lc SG/19 Fab fragment (Light chain) protein protein mouse Mus musculus Mouse DIVMTQATPSIPVTPGESVSISCRSNKSLLHSNGNTYLYWFLQRPGQSPRLLIFRMSNLASGVPDRFSGSGSGTAFTLRISRVEAADVGIYFCLQHLEYPFTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC rgd peptide RGD peptide: RGDNP peptide peptide polypeptide oligopeptide oligopeptide polypeptide synthetic construct synthetic construct RGDNP finc_human Fibronectin FN1 FN Cold-insoluble globulin protein protein human Homo sapiens Human MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTFAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE DIP protein P02751 original sequence version: 119 DIP protein P02751 original sequence version: 131 DIP protein P02751 original sequence version: 154 DIP protein P02751 original sequence version: 156 DIP protein P02751 original sequence version: 157 DIP protein P02751 original sequence version: 155 DIP protein P02751 original sequence version: 194 6C436A7A5FEE6DEB itga5-itgb1-6 1 5 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P05556:p.Thr112His mutation mutation certain certain sequence position certain certain certain sequence position certain T H P05556:p.Ser215Thr mutation mutation certain certain sequence position certain certain certain sequence position certain S T crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. T112H and S215T are known sequence conflicts annotated in Uniprot (PubMed: 2958481). 6 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role neutral component neutral component purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 8 unspecified role unspecified role neutral component neutral component purified purified RGD peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain synthetic construct synthetic construct 7 unspecified role unspecified role neutral component neutral component purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association Fig. 1A, Table 1 itga5-itgb1-7 1 5 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P05556:p.Thr112His mutation mutation certain certain sequence position certain certain certain sequence position certain T H P05556:p.Ser215Thr mutation mutation certain certain sequence position certain certain certain sequence position certain S T crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. T112H and S215T are known sequence conflicts annotated in Uniprot (PubMed: 2958481). 6 unspecified role unspecified role neutral component neutral component purified purified C-terminal tag C-terminal tag: GGLENLYFQ tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role neutral component neutral component purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 7 unspecified role unspecified role neutral component neutral component purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association Fig. 1, Table 1 fn1-itga5-6 3 4 competitor competitor competitor unspecified role unspecified role purified purified antibody hc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 7 competitor competitor competitor unspecified role unspecified role purified purified antibody lc sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role prey prey purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait purified purified FNIII 8-11 Fibronectin type III 8-11 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3 The basic buffer contained Mn2+ but the concentration dependent binding was measured in a Ca2+/Mg2+ buffer. fn1-itga5-5 2 5 unspecified role unspecified role bait bait purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role prey prey purified purified FNIII 8-11 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P02751:p.[Arg1496Ala;Pro1498Ala;Arg1501Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Tue Oct 05 19:38:33 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P02751:p.[Arg149Ala;Pro1498Ala;Arg1501Ala]' biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) The 3 mutations (R1496A, P1498A and R1501A) were present simultaneously in the protein. There is no experiment about their individual effect. 6 unspecified role unspecified role bait bait purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08648:p.Glu122Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Mon Jun 28 17:08:12 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P08648:pGlu122Ala' P08648:p.Glu165Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Mon Jun 28 17:44:02 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P08648:pGlu165Ala' P08648:p.Asp195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Mon Jun 28 16:47:09 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P08648:pAsp195Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 7A fn1-itga5-7 3 5 unspecified role unspecified role prey prey purified purified ITGB1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 6 unspecified role unspecified role prey prey purified purified ITGA5 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P08648:p.Asp195Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Mon Jun 28 17:10:58 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P08648:pAsp195Ala' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 9 unspecified role unspecified role bait bait purified purified FNIII 8-11 Fibronectin type III 8-11 domains sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N-terminal Cys tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range biotin tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P02751:p.Arg1501Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 17:21:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P02751:pArg1501Ala' ecoli Escherichia coli (strain K12) physical association physical association Figs. 3, 7B