IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. The Journal of biological chemistry 2009 imex curation Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease Cross-linker: Glutaraldehyde (CHEBI:64276) mori@sbchem.kyoto-u.ac.jp Accepted 2021-SEP-27 AT 14:40 BST AT 14:40 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. The Journal of biological chemistry 2009 imex curation Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Accepted 2021-SEP-27 AT 14:40 BST AT 14:40 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. The Journal of biological chemistry 2009 imex curation Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Only protein-protein interactions imex curation pig-llcpk Sus scrofa kidney cell line LLCPK llcpk Porcine kidney cell line confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Accepted 2021-SEP-27 AT 14:40 BST AT 14:40 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. The Journal of biological chemistry 2009 imex curation Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Accepted 2021-SEP-27 AT 14:40 BST AT 14:40 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. A pathogenic C terminus-truncated polycystin-2 mutant enhances receptor-activated Ca2+ entry via association with TRPC3 and TRPC7. The Journal of biological chemistry 2009 imex curation Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease mori@sbchem.kyoto-u.ac.jp Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Miyagi K., Kiyonaka S., Yamada K., Miki T., Mori E., Kato K., Numata T., Sawaguchi Y., Numaga T., Kimura T., Kanai Y., Kawano M., Wakamori M., Nomura H., Koni I., Yamagishi M., Mori Y. Rare diseases - Interactions investigated in the context of Rare genetic disease There is no significant difference in usage of Nonidet P-40/deoxycholate/SDS-based stringent RIPA lysis buffer or Nonidet P-40/Triton X-100-based high salt IP-500 buffer mori@sbchem.kyoto-u.ac.jp Accepted 2021-SEP-27 AT 14:40 BST AT 14:40 BST by ORCHARD The Journal of biological chemistry 2009 Only protein-protein interactions imex curation imex curation pkd2_human Polycystin-2 PKD2 Polycystic kidney disease 2 protein Autosomal dominant polycystic kidney disease type II protein Polycystwin R48321 TRPP2 Transient receptor potential cation channel subfamily P member 2 protein protein human Homo sapiens Human MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIRQAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRPGSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGPRNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLEDQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV Functions as a calcium permeable cation channel. PKD1 and PKD2 may function through a common signaling pathway that is necessary for normal tubulogenesis Defects in PKD2 are the cause of polycystic kidney disease autosomal dominant type 2 (ADPKD2) [MIM:173900]. ADPKD2 represents approximately 15% of the cases of ADPKD, a common genetic disease affecting about 1:400 to 1:1000 individuals. ADPKD is characterized by progressive formation and enlargement of cysts in both kidneys, typically leading to end-stage renal disease in adult life. Cysts also occurs in the liver and other organs. ADPKD2 is clinically milder than ADPKD1 but it has a deleterious impact on overall life expectancy mint F8D2E760EBEA8B47 trpc1_mouse Short transient receptor potential channel 1 Transient receptor protein 1 Trp-related protein 1 Trpc1 Trp1 Trrp1 protein protein mouse Mus musculus Mouse MMAALYPSTDLSGVSSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLGFRTSKYAMFYPRN CBECB08C0D72E5DF trpc3_mouse Short transient receptor potential channel 3 Trp3 Trrp3 Trpc3 Receptor-activated cation channel TRP3 Transient receptor protein 3 Trp-related protein 3 protein protein mouse Mus musculus Mouse MRDKGRRQAVRGPAFMFGARGPSLTAEEERFLDAAEYGNIPVVRKMLEESRTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILGHPGFAASRRLTLSPCEQELRDDDFYAYDEDGTRFSPDITPIILAAHCHKYEVVHLLLLKGARIERAHDYFCRCSDCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLERHGHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYIVQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSHVQESDLSEVTLPPEVQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFILYSYYLGAKVNPAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRITNFSKCRRRRLQKDLELGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSVLRCE DIP protein Q9QZC1 original sequence version: 109 7B863B209B9A25F8 trpc7_mouse Short transient receptor potential channel 7 Trpc7 Trp7 Trrp8 Transient receptor protein 7 protein protein mouse Mus musculus Mouse MLGSNTFKNMQRRHTTLREKGRRQAIRGPAYMFNEKGTSLTPEEERFLDSAEYGNIPVVRKMLEESKTLNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILNGDVNLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKASEAQLYVDQYVQDVTLHNVSLPPEVAYFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAKYNPAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIMRIKMCLIELCQSKAKRCENDLEMGMLNSKFRKTRYQAGMRNSENLTANSTFSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSEKFGKNLNKDHLRVNQGKDI C2EB2CE1A6AF9C3D f1s1u0_pig TRPC3 protein protein pig Sus scrofa (Pig) Pig MSTKVRKCKEQVRVTFPAPEEEEEESEDEGAEPQRRRRGWRGVNGGLEPRLAPSQREPHGYCPPPFSPRPDMSMEESPSLRRKTVMREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKRLTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDYFCKCGDCTEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEMHRHKASLSRVKLAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTVAIKCLVVLVVALGLPFLAIGYWIAPCSRLGKVLRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVIDYPKQIFRVKTTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFLQATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFILYSYYLGAKVNAAFTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRIINFSKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKAQVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE DAD99646AA976A5D pkd2-trpc1-15 5 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6a pkd2-trpc3-1 5 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region Q13563:p.Arg742* sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6a, SF5, SF7 pkd2-trpc7-1 5 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 6a pkd2-trpc3-2 4 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation mutation certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 6b pkd2-trpc3-3 1 6 unspecified role unspecified role neutral component neutral component purified purified n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation mutation certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role neutral component neutral component purified purified tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 6c pkd2-trpc1-16 2 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6d pkd2-trpc3-4 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13563:p.Met698_Val968delinsTrpAsnSerGlnIleLeuSerGluArgAlaThrIleLysLeuTrpSerAsn Q13563:pMet698Trpfs*18 mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain MELSDLIRKGYHKALVKLKLKKNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV WNSQILSERATIKLWSN 10 antibody detection identification by antibody antibody detection tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization 7