UniProt UniProt http://www.uniprot.org Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro ms interact detect detection by mass spectrometry ms interact detect predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. Electrospray Ionisation Fourier transform ion cyclotron resonance mass spectrometry olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. NMR chemical shift perturbation olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. Experiments were carried out in the presence of a fluorescent probe - 6,P-toluidinylnaphthalene-2-sulfonate (TNS). olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function. BMC biochemistry 2009 imex curation Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Moroz OV., Burkitt W., Wittkowski H., He W., Ianoul A., Novitskaya V., Xie J., Polyakova O., Lednev IK., Shekhtman A., Derrick PJ., Bjoerk P., Foell D., Bronstein IB. olga@ysbl.york.ac.uk Accepted 2022-JAN-26 AT 09:29 GMT AT 09:29 GMT by MGT BMC biochemistry 2009 Only protein-protein interactions imex curation imex curation calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) s10ac_human Protein S100-A12 S100A12 CGRP Calcium-binding protein in amniotic fluid 1 Calgranulin-C Extracellular newly identified RAGE-binding protein Neutrophil S100 protein S100 calcium-binding protein A12 Migration inhibitory factor-related protein 6 protein protein human Homo sapiens Human MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE 52AF75A31BDC222A zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP DIP protein Q15109 original sequence version: 157 0D584C436C30CCE7 ager-s100a12-1 7 11 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 9 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2A, 2B Interaction is Ca2+ and Zn2+-dependent s100a12-ager-1 7 11 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus fc-igg1 fc-igg1 c-term range C-terminal range c-term range c-term range C-terminal range c-term range mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc 9 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2C Interaction is Ca2+ and Zn2+-dependent s100a12-calcium(2+)-2 2 8 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 Interaction is Ca2+ and Zn2+-dependent s100a12-calcium(2+)-1 2 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 s100a12-1 4 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4H Dimeric in the presence of EDTA s100a12-3 4 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4H Tetrameric in the presence of zinc s100a12-4 4 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4H Hexameric in the presence of zinc and calcium s100a12-s100a12-1 4 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4H Oligomeric in the presence of increasing calcium concentrations s100a12-5 1 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5A s100a12-6 1 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5A, 5B, 5D calcium(2+)-s100a12-1 1 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5C, 5E, 5F Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. s100a12-7 1 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.5D calcium(2+)-s100a12-2 1 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5E, 5F Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-3 1 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5E, 5F Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-4 6 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6B, 7A, Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. s100a12-zinc(2+)-1 6 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.6C, 7A Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-5 6 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig.7A, Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-6 3 8 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6A, 7B Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. s100a12-zinc(2+)-2 3 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 6A, 7B, 8 Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-7 3 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role unspecified role unspecified role 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 6A, 7B, 8 Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+. calcium(2+)-s100a12-8 5 10 unspecified role unspecified role unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role unspecified role unspecified role region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig 9 Bound Zn2+ increases the affinity of the S100A12 dimers for Ca2+.