DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of SRP54 and SRP19, the two proteins that organize the ribonucleic core of the signal recognition particle from Pyrococcus furiosus. Structures of SRP54 and SRP19, the two proteins that organize the ribonucleic core of the signal recognition particle from Pyrococcus furiosus. PloS one 2007 imex curation Egea PF., Napetschnig J., Walter P., Stroud RM. stroud@msg.ucsf.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation pyrfu Pyrococcus furiosus x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Egea PF., Napetschnig J., Walter P., Stroud RM. stroud@msg.ucsf.edu Accepted 2021-APR-26 AT 07:33 BST AT 07:33 BST by ORCHARD PloS one 2007 imex curation srp54_pyrfu Signal recognition particle 54 kDa protein srp54 PF1731 protein protein pyrfu Pyrococcus furiosus MVLDNLGKALANTLKKIARASSVDEALIKELVRDIQRALIQADVNVRLVLQLTREIQRRALEEKPPAGISKKEHIIKIVYEELTKFLGTEAKPIEIKEKPTILLMVGIQGSGKTTTVAKLARYFQKRGYKVGVVCSDTWRPGAYHQLRQLLDRYHIEVFGNPQEKDAIKLAKEGVDYFKSKGVDIIIVDTAGRHKEDKALIEEMKQISNVIHPHEVILVIDGTIGQQAYNQALAFKEATPIGSIIVTKLDGSAKGGGALSAVAATGAPIKFIGTGEKIDDIEPFDPPRFVSRLLGLGDIQGLLEKFKELEKEVEIKEEDIERFLRGKFTLKDMYAQLEAMRKMGPLKQILRMIPGLGYSLPDDVISIGEERLKKFKVIMDSMTEEELLNPEIINYSRIKRIARGSGTSTKDVKELLDQYRQMKKLFKSMNKRQLSRLARRFGM 102D1717B207F71A srp19_pyrfu Signal recognition particle 19 kDa protein srp19 PF1894 protein protein pyrfu Pyrococcus furiosus MGRFVVWPSELDSRLSRKYGRIVPRSIAVESPRVEEIVRAAEELKFKVIRVEEDKLNPRLSGIDEELRTFGMIVLESPYGKSKSLKLIAQKIREFRRRSA 648EF600402C9CD6 srp19-1 1 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 7, Table 1 srp54-1 1 2 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2, Table 1