UniProt UniProt http://www.uniprot.org Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Molecular endocrinology (Baltimore, Md.) 2008 imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret anti-tag immunocytochemistry anti-tag immunocytochemistry Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. To assess heterodimer formation, an anti-HA antibody conjugated to fluorescein was used as the fluorescence donor and an anti-c-Myc antibody conjugated to rhodamine as the acceptor. For homodimer formation, anti-Myc monoclonal antibodies conjugated to fluorescein acted as fluorescence donor or to rhodamine as the acceptor. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Accepted 2021-AUG-09 AT 08:48 BST AT 08:48 BST by MGT Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Molecular endocrinology (Baltimore, Md.) 2008 imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Accepted 2021-AUG-09 AT 08:48 BST AT 08:48 BST by MGT Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Cell growth inhibition and functioning of human somatostatin receptor type 2 are modulated by receptor heterodimerization. Molecular endocrinology (Baltimore, Md.) 2008 imex curation Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U., Grant M., Alturaihi H., Jaquet P., Collier B., Kumar U. Species of origin of ARRB2 taken from work of the contributing author (PMID: 17827242) ujkumar@interchange.ubc.ca Accepted 2021-AUG-09 AT 08:48 BST AT 08:48 BST by MGT Molecular endocrinology (Baltimore, Md.) 2008 Only protein-protein interactions imex curation imex curation arrb2_human Beta-arrestin-2 Arrestin beta-2 ARRB2 ARB2 ARR2 Non-visual arrestin-3 protein protein human Homo sapiens Human MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC DIP protein P32121 original sequence version: 148 DIP protein P32121 original sequence version: 102 DIP protein P32121-1 original sequence version: 86 DIP protein P32121-1 original sequence version: 100 DIP protein P32121 original sequence version: 153 DEEC507D4A7B84FF ssr2_human Somatostatin receptor type 2 SSTR2 SRIF-1 protein protein human Homo sapiens Human MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI 3B5D7D8A9AC246C6 ssr5_human Somatostatin receptor type 5 SSTR5 protein protein human Homo sapiens Human MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL 905744715F31121C sstr2-sstr5-1 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig.1B L-779,976 (CHEBI:176977) sstr2-sstr5-2 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig.1D, 2A L-779,976 (CHEBI:176977) sstr5-1 1 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig.1E Somatostatin-14 (PRO_0000033088) sstr2-arrb2-1 3 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.4A L-779,976 (CHEBI:176977) Somatostatin-14 (PRO_0000033088) sstr2-sstr5-3 3 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.5 Somatostatin-14 (PRO_0000033088) sstr5-sstr2-1 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp. Fig.1 L-779,976 (CHEBI:176977) arrb2-sstr2-1 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 tag fluorescence tag visualisation by fluorescence tag fluorescence anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.4B L-779,976 (CHEBI:176977) Somatostatin-14 (PRO_0000033088) SSRT5 (P35346)