DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Asymmetry in the structure of the ABC transporter-binding protein complex BtuCD-BtuF. Asymmetry in the structure of the ABC transporter-binding protein complex BtuCD-BtuF. Science (New York, N.Y.) 2007 imex curation Hvorup RN., Goetz BA., Niederer M., Hollenstein K., Perozo E., Locher KP. kaspar.locher@mol.biol.ethz.ch Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hvorup RN., Goetz BA., Niederer M., Hollenstein K., Perozo E., Locher KP. kaspar.locher@mol.biol.ethz.ch Accepted 2021-AUG-23 AT 10:20 BST AT 10:20 BST by KALPANAP Science (New York, N.Y.) 2007 Only protein-protein interactions imex curation IMEx imex curation btuc_ecoli Vitamin B12 import system permease protein BtuC btuC b1711 JW1701 protein protein ecoli Escherichia coli (strain K12) MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMMGGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLKAGR DIP protein P06609 original sequence version: 96 DIP protein P06609 original sequence version: 131 DIP protein P06609 original sequence version: 114 C65882B1C47BFE69 btuf_ecoli Vitamin B12-binding protein yadT btuF b0158 JW0154 protein protein ecoli Escherichia coli (strain K12) MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD DIP protein P37028 original sequence version: 92 DIP protein P37028 original sequence version: 126 DIP protein P37028 original sequence version: 110 480F2E620ACD6EA1 btud_ecoli Vitamin B12 import ATP-binding protein BtuD btuD b1709 Vitamin B12-transporting ATPase JW1699 protein protein ecoli Escherichia coli (strain K12) MSIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGMTSGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLLLDEPMNSLDVAQQSALDKILSALCQQGLAIVMSSHDLNHTLRHAHRAWLLKGGKMLASGRREEVLTPPNLAQAYGMNFRRLDIEGHRMLISTI DIP protein P06611 original sequence version: 101 DIP protein P06611 original sequence version: 138 DIP protein P06611 original sequence version: 119 760004A5C0134245 btuc-btud-13 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22-266 region 22-266 region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified P06611:p.Cys180Ser Cys-less mutation mutation certain certain sequence position certain certain certain sequence position certain C S ecoli Escherichia coli (strain K12) 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified P06609:p.[Cys18Ser;Cys32Ser;Cys120Ser;Cys156Ser;Cys205Ser;Cys206Ser;Cys267Ser] Cys-less mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Tue Oct 05 18:50:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P06609:p,[Cys18Ser,Cys32Ser,Cys120Ser,Cys156Ser,Cys205Ser,Cys206SerCys267Ser]' ecoli Escherichia coli (strain K12) physical association physical association Figure 1, Table S1