UniProt UniProt http://www.uniprot.org The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Molecular biology of the cell 2005 imex curation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-jy5 JY5 B-cell line jy5 JY5 B-cell tap tandem affinity purification TAP TAP tap edman degradation edman degradation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. That all proteins were identified by sequencing given in M&M. tkinoshi@biken.osaka-u.ac.jp Accepted 2021-MAR-26 AT 16:19 GMT AT 16:19 GMT by PPORRAS Molecular biology of the cell 2005 Only protein-protein interactions imex curation imex curation The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Molecular biology of the cell 2005 imex curation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-jy5 JY5 B-cell line jy5 JY5 B-cell pull down pull down anti tag western anti tag western blot anti tag western Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. Precipitates pull downed with glutathione beads and second precipitates by anti-HA beads tkinoshi@biken.osaka-u.ac.jp Accepted 2021-MAR-26 AT 16:19 GMT AT 16:19 GMT by PPORRAS Molecular biology of the cell 2005 Only protein-protein interactions imex curation imex curation The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Molecular biology of the cell 2005 imex curation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-daudi Homo sapiens Burkitt's B-cell lymphona cells daudi Homo sapies DAUDI Burkitt's B-cell lymphoma tap tandem affinity purification TAP TAP tap weight identificat confirmation by molecular weight weight identificat Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. Precipitates pull downed with glutathione beads and second precipitates by anti-FLAG beads tkinoshi@biken.osaka-u.ac.jp Accepted 2021-MAR-26 AT 16:19 GMT AT 16:19 GMT by PPORRAS Molecular biology of the cell 2005 Only protein-protein interactions imex curation imex curation The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Molecular biology of the cell 2005 imex curation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-jy25 Homo sapiens B--lymphoblastoid JY25 cells jy25 Human B-lymphoblastoid JY25 cells pull down pull down anti tag western anti tag western blot anti tag western Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. Precipitates pull downed with glutathione beads and second precipitates by anti-HA beads tkinoshi@biken.osaka-u.ac.jp Accepted 2021-MAR-26 AT 16:19 GMT AT 16:19 GMT by PPORRAS Molecular biology of the cell 2005 Only protein-protein interactions imex curation imex curation The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component. Molecular biology of the cell 2005 imex curation Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-f9 Mus musculus f9 Mouse F9 129 embryo teratocarcinoma pull down pull down anti tag western anti tag western blot anti tag western Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T., Murakami Y., Siripanyaphinyo U., Hong Y., Tashima Y., Maeda Y., Kinoshita T. tkinoshi@biken.osaka-u.ac.jp Accepted 2021-MAR-26 AT 16:19 GMT AT 16:19 GMT by PPORRAS Molecular biology of the cell 2005 Only protein-protein interactions imex curation imex curation dpm2_human Dolichol phosphate-mannose biosynthesis regulatory protein DPM2 Dolichol-phosphate mannose synthase subunit 2 My026 protein protein human Homo sapiens Human MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ 0247A0843A711EE9 pigy_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y PIGY Phosphatidylinositol-glycan biosynthesis class Y protein protein protein human Homo sapiens Human MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN 143975D8CCECED34 piga_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit A PIGA GlcNAc-PI synthesis protein Phosphatidylinositol-glycan biosynthesis class A protein protein protein human Homo sapiens Human MACRGGAGNGHRASATLSRVSPGSLYTCRTRTHNICMVSDFFYPNMGGVESHIYQLSQCLIERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYNQSTATTLFHSLPLLRYIFVRERVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHKDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTRVGGIPEVLPENLIILCEPSVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDRVSVEAVLPMDKRLDRLISHCGPVTGYIFALLAVFNFLFLIFLRWMTPDSIIDVAIDATGPRGAWTNNYSHSKRGGENNEISETR 34DCD074A3920852 pigp_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit P Down syndrome critical region protein 5 Down syndrome critical region protein C Phosphatidylinositol-glycan biosynthesis class P protein NPD010 PIGP DCRC DSCR5 DSCRC protein protein human Homo sapiens Human MVPRSTSLTLIVFLFHRLSKAPGKMVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFIPESWLNSLGLTYWPQKYWAVALPVYLLIAIVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN pigq_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q PIGQ GPI1 Phosphatidylinositol-glycan biosynthesis class Q protein N-acetylglucosamyl transferase component GPI1 protein protein human Homo sapiens Human MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGAPGEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSEGVEASILAELARRASGPICLLLASLLSLVSAVSACRVFKLWPLSFLGSKLSTCEQLRHRLEHLTLIFSTRKAENPAQLMRKANTVASVLLDVALGLMLLSWLHGRSRIGHLADALVPVADHVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIHLMSPFVEHILWHVGLSACLGLTVALSLLSDIIALLTFHIYCFYVYGARLYCLKIHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILLFLLPTTALYYLVFTLLRLLVVAVQGLIHLLVDLINSLPLYSLGLRLCRPYRLADKPTALQPRGAHLPPPQLWLPPQALLGRPVPQAVPWGAHLPLEAERGQAGLRELLARLAPPHGHSQPSALPGWHQLSWRMSCALWTLLCAPEHGRPCYHTLGLEVIGSEQMWGWPARLAALHHWHCLPWDPLPTCCGHHGGEHSNPRCPEHCPMPTLCTQVQRVRPPQQPQVEGWSPWGLPSGSALAVGVEGPCQDEPPSPRHPLAPSAEQHPASGGLKQSLTPVPSGPGPSLPEPHGVYLRMFPGEVAL DBF900ADCE08DA98 pigc_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit C Phosphatidylinositol-glycan biosynthesis class C protein PIGC GPI2 protein protein human Homo sapiens Human MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS BD9584C5D5203A4B pigh_human Phosphatidylinositol N-acetylglucosaminyltransferase subunit H Phosphatidylinositol-glycan biosynthesis class H protein PIGH protein protein human Homo sapiens Human MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCENSMILSAAIFITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP EE70E4156272AC8B piga-pigy-1 1 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2A piga-pigh-2 3 9 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 7A piga-pigc-1 3 9 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 weight identificat confirmation by molecular weight weight identificat anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 7A piga-pigy-2 4 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 8A piga-pigy-3 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 8A piga-pigy-4 5 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 8B Interaction observed in Pigq-/- cells piga-pigq-2 5 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig. 8B Interaction observed in Pigq-/- cells