UniProt UniProt http://www.uniprot.org Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7. Journal of cell science 2005 imex curation Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Only protein-protein interactions imex curation crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M., Lin PJ., Williams WP., Luu Y., Molday RS., Orlowski J., Numata M. mnumata@interchange.ubc.ca Accepted 2021-JUL-13 AT 14:32 BST AT 14:32 BST by MGT Human brain cDNA Journal of cell science 2005 Only protein-protein interactions imex curation imex curation scam1_human Secretory carrier-associated membrane protein 1 SCAMP1 SCAMP protein protein human Homo sapiens Human MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI C5745732744BE3C7 scam5_rat Secretory carrier-associated membrane protein 5 Scamp5 protein protein rat Rattus norvegicus (Rat) Rat MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSTTPNYTYSNEM 5C2C35578FB1399F scam1_rat Secretory carrier-associated membrane protein 1 Scamp1 Scamp SCAMP 37 protein protein rat Rattus norvegicus (Rat) Rat MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM 72E3BAD6A8FEBF59 scam5_human Secretory carrier-associated membrane protein 5 SCAMP5 protein protein human Homo sapiens Human MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM D3CFF3C9EF2FC6FF q5u2u4_rat Secretory carrier-associated membrane protein Scamp2 protein protein rat Rattus norvegicus (Rat) Rat MSAFDTNPFADPVDVNPFQDPSVTQLTSAPQSGLAEFNPFSETNAATTVPVTQLPGPSQPAVLQPSVEPAQPSPQAVAAAAQAGLLRQQEELDRKAAELERKERELQNTAANLHVRENNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFTSDAANGTAFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYFIQLIGLPNLGTSGWLAALSTVNKGPLAVTIIMMVVAGFFTLCAGLSLFLLQRVHAFYRRTGASFQQAQEEFSQGIFSSRTFRTAASSAARGTFQGN B02EBC17A03B10BB scam2_human Secretory carrier-associated membrane protein 2 SCAMP2 protein protein human Homo sapiens Human MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN 046ACB926FD951DD sl9a7_human Sodium/hydrogen exchanger 7 SLC9A7 NHE7 Na(+)/H(+) exchanger 7 Solute carrier family 9 member 7 protein protein human Homo sapiens Human MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGTPATSGRDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGKINSVEQNDMLRKVTFDPEVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIMGQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSSSIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKFTKLHCFPLLETALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLAENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQHMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWYSFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLREEDSDFILTEGDLTLTYGDSTVTANGSSSSHTASTSLEGSRRTKSSSEEVLERDLGMGDQKVSSRGTRLVFPLEDNA 14E50B197863E38F scamp2-slc9a7-1 5 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association slc9a7-scamp2-1 3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 1B, 3 slc9a7-scamp1-1 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B slc9a7-scamp5-1 3 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B slc9a7-scamp2-2 2 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role bait bait purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 2 scamp2-slc9a7-2 2 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain in vitro In vitro physical association physical association Fig. 4B slc9a7-scamp1-3 4 11 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal 1d4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 5A slc9a7-scamp2-3 1 11 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal 1d4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 5B scamp1-slc9a7-1 1 9 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal 1d4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 5B scamp5-slc9a7-1 1 8 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal 1d4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 5B scamp2-slc9a7-3 6 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal 1d4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig. 8A A SCAMP2 mutant lacking amino acids Δ184-208 displayed scattered staining as did the NHE71D4 signal but it continued to closely, but not completely, overlap that of SCAMP2/delta184-208. scamp2-scamp2-1 3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 8C slc9a7-scamp2-4 3 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 10A slc9a7-scamp2-5 2 12 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 13 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 10B slc9a7-scamp2-6 6 12 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figs. 10C scamp2-slc9a7-4 6 12 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figs. 11 A SCAMP2 construct lacking 184-208 showed more limited colocalization with SLC9A7 scamp2-scamp2-2 6 12 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 8B SCAMP2 exhibited a more scattered vesicular appearance when co-expressed with a SCAMP2 construct missing residues 184-208, but not with other deletion mutants lacking either transmembrane region1 (151-174) or transmembrane region (218-242)